Engadget http://www.engadget.com Engadget http://www.blogsmithmedia.com/www.engadget.com/media/feedlogo.gif Engadget http://www.engadget.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[ITC says again that Apple and RIM don't violate Kodak patent]]>http://www.engadget.com/2012/05/21/itc-says-again-that-apple-and-rim-dont-violate-kodak-patent/http://www.engadget.com/2012/05/21/itc-says-again-that-apple-and-rim-dont-violate-kodak-patent/http://www.engadget.com/2012/05/21/itc-says-again-that-apple-and-rim-dont-violate-kodak-patent/#comments Kodak, Apple and RIM go pow

Kodak hasn't caught a break lately, and that trend isn't easing up any time soon with a second rejection arriving in its main International Trade Commission (ITC) patent dispute with Apple and RIM. Despite having had its case remanded after a loss last year, Kodak is once more being told that BlackBerrys and iPhones don't violate a patent on previewing photos. The one violation was rendered moot through "obviousness," according to administrative law judge Thomas Pender. It's still an initial ruling, and Kodak is trying to put a positive light on the situation -- it's "pleased" there's still an infringement, even if the patent claim is invalid -- but the patent wars aren't looking good for a photography company that has already had to give up cameras to have a chance of staying afloat. Most of Kodak's hope, then, will be pinned on a second wave of ITC disputes that might stand a better chance of putting at least Apple's feet to the fire.

Continue reading ITC says again that Apple and RIM don't violate Kodak patent

ITC says again that Apple and RIM don't violate Kodak patent originally appeared on Engadget on Mon, 21 May 2012 15:59:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>AppleApple iPhoneAppleIphoneBankruptbankruptcyBlackBerrycameracamerascellphonecellphonesdisputedisputesimaginginternational trade commissionInternationalTradeCommissioniphoneitcKodakmobilepostcrosspatentpatentsphotographyResearch In MotionResearchInMotionRIMrulingsmartphonesmartphonesus international trade commissionus itcUsInternationalTradeCommissionUsItcMon, 21 May 2012 15:59:00 EST<![CDATA[UnEasyshare: Kodak's now-defunct, Rochester-based nuclear reactor]]>http://www.engadget.com/2012/05/14/uneasyshare-kodaks-now-defunct-rochester-based-nuclear-reacto/http://www.engadget.com/2012/05/14/uneasyshare-kodaks-now-defunct-rochester-based-nuclear-reacto/http://www.engadget.com/2012/05/14/uneasyshare-kodaks-now-defunct-rochester-based-nuclear-reacto/#comments ImageReady for this unsettling Kodak moment? It seems the one-time imaging powerhouse held a decades-long secret deep in a bunker below Building 82 on its Rochester campus. The now vacant facility, a concrete-shielded chamber built in 1974, was once home to a californium neutron flux multiplier (CFX) or, in layman's terms, a small nuclear reactor as recently as six years ago. Certainly, that's not the technology one would normally associate with an outfit built on the foundations of photography, but according to recently released documents, its three and a half pound store of enriched uranium was used primarily for neutron radiography -- an imaging technique -- and chemical purity testing. The site's long been shut down and the radioactive material in question carted off with federal oversight, but for denizens of that upstate New York territory, alarming news of the reactor's existence has only just surfaced. Before you cast Kodak the evil side eye, bear in mind post-9/11 policies forbade the company from making the whereabouts of its small reactor widely known, though earlier scientific studies did make reference to the CFX's existence. It's an eye-opening glimpse into the esoteric machinations of private industry and the deadly dangers that lurk below your feet.

UnEasyshare: Kodak's now-defunct, Rochester-based nuclear reactor originally appeared on Engadget on Mon, 14 May 2012 14:17:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>californium neutron flux multiplierCaliforniumNeutronFluxMultiplierKodakneutron imagingneutron radiographyNeutronImagingNeutronRadiographyNuclear reactorNuclearReactorradiationRochesterMon, 14 May 2012 14:17:00 EST<![CDATA[Nokia gets it: launches patent lawsuits against HTC, RIM and Viewsonic]]>http://www.engadget.com/2012/05/02/nokia-patent-lawsuit/http://www.engadget.com/2012/05/02/nokia-patent-lawsuit/http://www.engadget.com/2012/05/02/nokia-patent-lawsuit/#comments Image

Nokia has just announced that it is commencing patent litigation against HTC, Research in Motion and Viewsonic in the US and Germany. It's claiming that a number of its patents are being infringed and has registered complaints with the ITC and courts in Delaware, Dusseldorf, Munich and Mannheim. Espoo's legal chief Louise Pentland has said that while the company currently licenses its FRAND patents to "more than 40 companies," it had no choice but to lay some courtroom smack-down on the named offenders. It appears that after losing its global market share crown and billion-dollar losses, the company is finally going on the offensive with its deep patent portfolio. You can judge that for yourself when you read the official line after the break.

Update: We've received some clarification from Nokia on what exactly is on the docket here. "Four of the patents asserted against Viewsonic in Mannheim are standards essential. The rest against Viewsonic and all against HTC and RIM are implementation patents, not declared essential to any standard and so we have no obligation to grant licenses."

Continue reading Nokia gets it: launches patent lawsuits against HTC, RIM and Viewsonic

Nokia gets it: launches patent lawsuits against HTC, RIM and Viewsonic originally appeared on Engadget on Wed, 02 May 2012 09:33:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>breaking newsDelawareDusseldorfFederal Court of DelawareFederalCourtOfDelawareFRANDHTCITCKodakLitigationLouise PentlandLouisePentlandMannheimNokiaPatentPatent LitigationPatentLitigationRegional CourtRegional Court DusseldorfRegionalCourtRegionalCourtDusseldorfResearch in MotionResearchInMotionRIMStandards EssentialStandardsEssentialViewSonicWed, 02 May 2012 09:33:00 EST<![CDATA[Kodak Gallery iOS app: now with 100 percent more physical printing at Target / CVS]]>http://www.engadget.com/2012/04/19/kodak-gallery-ios-app-printing-target-cvs/http://www.engadget.com/2012/04/19/kodak-gallery-ios-app-printing-target-cvs/http://www.engadget.com/2012/04/19/kodak-gallery-ios-app-printing-target-cvs/#comments kodak gallery target app

It's not quite as earth-shattering as Zuck's deal to snap up Instagram, but one of the pioneers of photography is making waves any way it can. Kodak Gallery has been available on the App Store since November of last year, but starting this week, users will be able to order photos right on their iPhone for pickup at participating Target and CVS locations in America. Kodak claims that the time between order and pickup is usually around an hour, with all prints (available in 4x6, 5x7 and 8x10 sizes) arriving on Kodak photo-quality paper. Pricing, as you'd expect, will vary by store, and more deets can be spotted in the release after the break.

Continue reading Kodak Gallery iOS app: now with 100 percent more physical printing at Target / CVS

Kodak Gallery iOS app: now with 100 percent more physical printing at Target / CVS originally appeared on Engadget on Thu, 19 Apr 2012 00:22:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>androidappapp storeapplicationAppStorecvsgalleryiosiphonekodakKodak GalleryKodakGallerymobilepostminiprintprintingsoftwaretargetThu, 19 Apr 2012 00:22:00 EST<![CDATA[Judge says Apple can't pursue patent infringement case against Kodak]]>http://www.engadget.com/2012/03/08/judge-says-apple-cant-pursue-patent-infringement-case-against-k/http://www.engadget.com/2012/03/08/judge-says-apple-cant-pursue-patent-infringement-case-against-k/http://www.engadget.com/2012/03/08/judge-says-apple-cant-pursue-patent-infringement-case-against-k/#comments Apple was dealt a setback today in its efforts to prevent Kodak from selling up to $2.6 billion worth of digital imaging patents, with U.S. Bankruptcy Judge Allan Gropper ruling that it would be an "inappropriate way forward" to allow Apple to pursue patent litigation against the bankrupt company. For its part, Apple had argued that one of those patents -- concerning the ability to preview digital photos on an LCD screen -- was "misappropriated" from its own technology, and that Kodak therefore shouldn't be allowed to sell it off as part of the planned sale (something Kodak obviously disputes). On that point, the judge did agree that the matter should be resolved soon, just not in the manner in which Apple had been proceeding, further adding that he "would request that the parties report to me on their efforts to come up with a procedure that truly works."

Judge says Apple can't pursue patent infringement case against Kodak originally appeared on Engadget on Thu, 08 Mar 2012 15:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>applebankruptcykodaklawsuitlegallitigationpatentpatent infringementpatent suitPatentInfringementpatentsPatentSuitThu, 08 Mar 2012 15:45:00 EST<![CDATA[Kodak moves to block Apple's latest patent suit from proceeding in federal district court]]>http://www.engadget.com/2012/03/06/kodak-moves-to-block-apples-latest-patent-suit-from-proceeding/http://www.engadget.com/2012/03/06/kodak-moves-to-block-apples-latest-patent-suit-from-proceeding/http://www.engadget.com/2012/03/06/kodak-moves-to-block-apples-latest-patent-suit-from-proceeding/#comments
In a move that's sure to surprise no one, Kodak is fighting Apple's latest round of patent litigation -- a suit that would force Kodak to pause plans to sell up to $2.6 billion in digital imaging patents as a condition of its bankruptcy loan. In documents filed late last week, Kodak argued the dispute should be heard by the same bankruptcy court that's already overseeing its insolvency proceedings. In fact, Kodak's bankruptcy filing back in January caused all pending litigation (from Apple and RIM, among others) to come to a screeching halt, but Apple is nonetheless pushing for a reboot, arguing it's the owner of "a number of valuable patents," including one that could be lost if that planned $2 billion sale goes through. So where might this legal catfight take place? A bankruptcy judge is expected to hear arguments from both sides on Thursday.

Kodak moves to block Apple's latest patent suit from proceeding in federal district court originally appeared on Engadget on Tue, 06 Mar 2012 10:53:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>AppleBankruptbankruptcybankruptcy courtBankruptcyCourtKodakpatchpatentpatent trollPatent Trollspatent warpatentsPatentTrollPatentTrollsPatentWarTue, 06 Mar 2012 10:53:00 EST<![CDATA[Kodak agrees to sell Gallery online photo service to Shutterfly for $24 million]]>http://www.engadget.com/2012/03/02/kodak-agrees-to-sell-gallery-online-photo-service-to-shutterfly/http://www.engadget.com/2012/03/02/kodak-agrees-to-sell-gallery-online-photo-service-to-shutterfly/http://www.engadget.com/2012/03/02/kodak-agrees-to-sell-gallery-online-photo-service-to-shutterfly/#comments

Remember that Kodak Photo Gallery online picture service that we didn't use? It appears that years of shipping packed-in with the company's cameras have netted it some 75 million users, making it an asset that now-bankrupt Kodak has agreed to sell off to Shutterfly for $23.8 million. The deal isn't quite done yet, with Shutterfly's offer entered as a stalking horse bid while other buyers may also submit proposals before the process is targeted to close in the spring. This is all a part of Kodak's pivot away from digital cameras and related products as it focuses on enterprise services and desktop printers instead. Under the current agreement, current gallery customers uncomfortable with being shipped off to Shutterfly will be able to opt out and either download their stored pics or buy them on DVDs. Otherwise, their accounts will be transferred in a way that is "preserved, and protected" -- that is to say, almost entirely unlike the way they're handled on iOS and Android.

Continue reading Kodak agrees to sell Gallery online photo service to Shutterfly for $24 million

Kodak agrees to sell Gallery online photo service to Shutterfly for $24 million originally appeared on Engadget on Fri, 02 Mar 2012 06:56:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bankruptcycamerachapter 11Chapter11digital camerasDigitalCameraskodakkodak galleryKodakGalleryOnline PhotosOnlinePhotosphoto galleryPhotoGallerysaleshutterflyFri, 02 Mar 2012 06:56:00 EST<![CDATA[Kodak gets court approval to borrow $950 million, end theater sponsorship]]>http://www.engadget.com/2012/02/16/kodak-chapter-11-bankruptcy-financing-oscars/http://www.engadget.com/2012/02/16/kodak-chapter-11-bankruptcy-financing-oscars/http://www.engadget.com/2012/02/16/kodak-chapter-11-bankruptcy-financing-oscars/#comments
Kodak took another step along the road to recovery yesterday, after receiving court approval to borrow $950 million in restructuring funds. Nearly a month after the camera maker filed for Chapter 11 bankruptcy, US Bankruptcy Judge Allen Gropper granted Kodak's request on Thursday, allowing the company to continue operations during its ongoing transition. Gropper's decision, handed down in a Manhattan court, follows a series of negotiations between Kodak and its lenders, and adds an extra $300 million to the $650 million awarded during January's Chapter 11 filing. The company is also allowed to end its sponsorship of the Kodak Theatre in Los Angeles, after successfully arguing that doing so would be in the best interest of Kodak and its creditors. Under the deal, Kodak is obliged to pay $72 million over the course of 20 years. It currently shells out $3.6 million per year and still has $38 million in outstanding payments, but Kodak's lawyers argued that the agreement was too costly. Kodak Chairman and CEO Antonio Perez issued the following statement in response to yesterday's decision: "Today's agreement is another step towards ensuring that Kodak is positioned to execute on the goals the Company set out last month: Bolster our liquidity in the U.S. and abroad, monetize our non-strategic intellectual property, fairly resolve legacy liabilities, and enable Kodak to focus on its most valuable business lines."

Continue reading Kodak gets court approval to borrow $950 million, end theater sponsorship

Kodak gets court approval to borrow $950 million, end theater sponsorship originally appeared on Engadget on Thu, 16 Feb 2012 04:53:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>academy awardsAcademyAwardsAntonio PerezAntonioPerezapprovalbankruptcybusinesscamerachapter 11Chapter11corporatecreditordigital cameraDigitalCamerafinanceindustryjudgekodakkodak theatreKodakTheatreloanmoneyoscarsrestructuringThu, 16 Feb 2012 04:53:00 EST<![CDATA[Apple wants to file patent lawsuit against Kodak, fully aware that Kodak's bankrupt]]>http://www.engadget.com/2012/02/15/apple-kodak-patent-lawsuit-bankrupt/http://www.engadget.com/2012/02/15/apple-kodak-patent-lawsuit-bankrupt/http://www.engadget.com/2012/02/15/apple-kodak-patent-lawsuit-bankrupt/#comments Poor Kodak just can't catch a break these days. Nearly a month after filing for Chapter 11 bankruptcy and mere days after shuttering its digital camera business, the sputtering company now finds itself the target of no less a behemoth than Apple. Yesterday, Cupertino's legal team asked a US Bankruptcy Court for permission to go after Kodak on two legal fronts: with a patent infringement lawsuit in a Manhattan district court, and a corollary complaint in the ITC. According to Bloomberg, Apple's patent suit focuses on technologies that Kodak uses in its line of digital cameras, printers and digital picture frames. Unfortunately for Kodak, printers are one of the product areas it recently decided to focus on, as confirmed in last week's restructuring announcement. Salt, meet wound.

These two companies, of course, have been involved in an ongoing ITC battle over Kodak's image transfer technology, with the latest salvo coming last month, when the camera company launched a fresh batch of litigation against both Apple and HTC. If the bankruptcy court grants Apple's request, the company will head straight to court, in the hopes of obtaining a block against Kodak's allegedly infringing products. Kodak, meanwhile, could file a request to hold off the district level case until the ITC ruling comes through, though Apple said yesterday that it would press forward, regardless. The company was also quick to point out that it's not legally bound to request permission to sue a court-protected bankrupt company, but did so "out of an abundance of caution," which is really considerate, if you think about it.

Apple wants to file patent lawsuit against Kodak, fully aware that Kodak's bankrupt originally appeared on Engadget on Wed, 15 Feb 2012 07:53:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>applebankruptcybankruptcy courtBankruptcyCourtchapter 11Chapter11courtcupertinodigital cameradigital picture frameDigitalCameraDigitalPictureFrameinternational trade commissionInternationalTradeCommissionITCkodaklawlawsuitlegalpatentpatent infringementPatentInfringementprinterWed, 15 Feb 2012 07:53:00 EST<![CDATA[Kodak to shutter digital camera production this year]]>http://www.engadget.com/2012/02/09/kodak-to-shutter-digital-camera-production-this-year/http://www.engadget.com/2012/02/09/kodak-to-shutter-digital-camera-production-this-year/http://www.engadget.com/2012/02/09/kodak-to-shutter-digital-camera-production-this-year/#comments
This year has not been a kind one for Kodak. Last month, the photography pioneer announced that it was filing for bankruptcy (and suing Samsung, incidentally), and now the company has let it be known that it will be dropping out of the digital camera business -- and then some -- marking an end to its line of digital point-and-shoots, pocket camcorders and digital photo frames. Production will end the first half of this year. The future for the company will hold printers, brand licensing, enterprise services and photo labs. Kodak will, however, continue to honor warranties on existing products.

Kodak to shutter digital camera production this year originally appeared on Engadget on Thu, 09 Feb 2012 09:48:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bankruptbankruptcycameracamerasdigital camerasDigitalCameraskodakThu, 09 Feb 2012 09:48:00 EST<![CDATA[Kodak files Chapter 11 bankruptcy, expects to complete restructuring by 2013]]>http://www.engadget.com/2012/01/19/kodak-chapter-11-bankruptcy/http://www.engadget.com/2012/01/19/kodak-chapter-11-bankruptcy/http://www.engadget.com/2012/01/19/kodak-chapter-11-bankruptcy/#comments Apparently suing Samsung (again) wasn't the only pressing business for Kodak today, as it just announced it has -- as expected -- filed for Chapter 11 business reorganization in New York. You can read the details in the press release after the break or at the Kodak Transforms website, where Chairman and CEO Antonio Perez is quoted saying he hopes Kodak will "emerge a lean, world-class, digital imaging and materials science company". The company has obtained $950 million debtor-in-possession financing, which it claims will provide the liquidity needed to continue operations during the restructuring. As far as its recent parade of lawsuits against Samsung, Apple and HTC, Perez comments on "monetizing non-core IP assets" so we'd assume its lawyers will stay busy going forward.

Continue reading Kodak files Chapter 11 bankruptcy, expects to complete restructuring by 2013

Kodak files Chapter 11 bankruptcy, expects to complete restructuring by 2013 originally appeared on Engadget on Thu, 19 Jan 2012 00:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bankruptcybankruptcy protectionBankruptcyProtectionbreaking newsbusinesschapter 11chapter 11 bankruptcyChapter11Chapter11BankruptcyipkodaklawsuitpatentsrestructuringThu, 19 Jan 2012 00:45:00 EST<![CDATA[Kodak says smile Samsung, you're being sued for infringing five digital imaging patents]]>http://www.engadget.com/2012/01/18/kodak-sues-samsung-for-patent-infringement/http://www.engadget.com/2012/01/18/kodak-sues-samsung-for-patent-infringement/http://www.engadget.com/2012/01/18/kodak-sues-samsung-for-patent-infringement/#comments Kodak's been in a bit of a financial bind lately, and has been exploring various options to maximize profitability and get its balance sheet back in the black. After recently filing actions against Apple and HTC in the International Trade Commission, Kodak's legal team now has Samsung in its sights. According to a press release, Kodak has filed a federal suit in the Western District of New York alleging that several Sammy slates are infringing five of Kodak's digital imaging patents. The patents in question claim various image capture and transmission technologies, from taking and sending images via email to transferring digital pictures over a cellular network. We haven't gotten a peek at the complaint just yet to see which devices allegedly run afoul of Kodak's IP, but you can find the five patents in question in the PR after the break.

Continue reading Kodak says smile Samsung, you're being sued for infringing five digital imaging patents

Kodak says smile Samsung, you're being sued for infringing five digital imaging patents originally appeared on Engadget on Wed, 18 Jan 2012 16:28:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>digital imagesdigital imagingDigitalImagesDigitalImagingintellectual propertyIntellectualPropertyipkodaklawsuitlegallitigationpatentpatentssamsungWed, 18 Jan 2012 16:28:00 EST<![CDATA[Kodak's stock price exploded after restructuring announcement]]>http://www.engadget.com/2012/01/10/kodak-stock-price-bump/http://www.engadget.com/2012/01/10/kodak-stock-price-bump/http://www.engadget.com/2012/01/10/kodak-stock-price-bump/#comments
It's only January 10th and Kodak's already having a terrible year: six days ago the beloved photography company was preparing for Chapter 11, but today its stock price leapt by 45 percent (and counting). The cause? The announcement of a new plan intended to pull the troubled company into the 21st century and, more importantly, into the black. It's planning to simplify its business structure down to two divisions and reduce costs while pushing its successful range of printers. We've got the announcement after the break but hopefully we'll see the century-old company live to see another day.

Continue reading Kodak's stock price exploded after restructuring announcement

Kodak's stock price exploded after restructuring announcement originally appeared on Engadget on Tue, 10 Jan 2012 17:03:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>BankruptcyBusinessCESCES 2012Ces2012Chapter 11Chapter11Eastman KodakEastmanKodakKodakReorganizationStock PriceStockPriceTue, 10 Jan 2012 17:03:00 EST<![CDATA[Kodak files new ITC lawsuits against Apple and HTC]]>http://www.engadget.com/2012/01/10/kodak-files-new-itc-lawsuits-against-apple-and-htc/http://www.engadget.com/2012/01/10/kodak-files-new-itc-lawsuits-against-apple-and-htc/http://www.engadget.com/2012/01/10/kodak-files-new-itc-lawsuits-against-apple-and-htc/#comments
Kodak and Apple might already be embroiled in an existing brouhaha, but that's not stopping the company from going on the offensive with two new suits. Filed in the Western District of New York, the company alleges Apple's violated four of its patents and HTC five. The claims primarily center around transferring images on and off devices and cover a wide gamut including iPhones, various EVOs and tablets. FOSS Patents muses it's all a ruse to demonstrate there's still gold in Kodak's patent mine -- either way, the market's eating it up.

Continue reading Kodak files new ITC lawsuits against Apple and HTC

Kodak files new ITC lawsuits against Apple and HTC originally appeared on Engadget on Tue, 10 Jan 2012 16:54:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>applebrouhahacameraeastman kodakEastmanKodakhtcitckodaklawsuitpatentpatent lawsuitPatentLawsuitpatentsreorganizationTue, 10 Jan 2012 16:54:00 EST<![CDATA[Kodak intros new connected Easyshare M750 and Playfull Dual Camera, adds instant uploads over WiFi]]>http://www.engadget.com/2012/01/09/kodak-intros-new-connected-easyshare-m750-and-playfull-dual-came/http://www.engadget.com/2012/01/09/kodak-intros-new-connected-easyshare-m750-and-playfull-dual-came/http://www.engadget.com/2012/01/09/kodak-intros-new-connected-easyshare-m750-and-playfull-dual-came/#comments Fancy taking photos on the fly and then uploading them to your preferred list of social networks? Good thing, then, that Kodak has your best interests at heart. Announced at this year's CES extravaganza, the company's showing off two of its newest connected imaging devices -- the Kodak Playfull Dual Camera and Easyshare M750. The compact Playfull has a 12MP camera capable of full HD 1080p video capture at 60fps, with an accompanying Xenon flash and a port for an external mic. But those specs aren't the camera's real draw -- that'd be it's built-in WiFi ability. Using the Share Button, users can instantly upload photos and video to YouTube, Kodak's own Gallery, as well as Facebook. The company's more traditional looking point-and-shoot refresh, the Easyshare M750, touts a 16MP module, 3-inch capacitive touchscreen, a RETINAR HD 5x zoom lens and a similar capability to share content wirelessly via an available network or through an installable app on iOS, Android and BlackBerry. When it launches later this spring it'll retail for around $170 and come in a smattering of colors, like silver, teal blue and red. As for the Playfull, well, nothing's quite been announced on it yet, but that could all very well change this week. Check out the official pressers after the break.

Continue reading Kodak intros new connected Easyshare M750 and Playfull Dual Camera, adds instant uploads over WiFi

Kodak intros new connected Easyshare M750 and Playfull Dual Camera, adds instant uploads over WiFi originally appeared on Engadget on Mon, 09 Jan 2012 17:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1080p12 megapixel12Megapixel16 megapixel16MegapixelCESCES 2012Ces2012connected camerasConnectedCamerasEasyshareEasyshare M750EasyshareM750KodakM750PlayfullPlayfull Dual CameraPlayfullDualCameraWiFi-enabledMon, 09 Jan 2012 17:45:00 EST<![CDATA[The Kodak Moment it never wanted: company reportedly prepping for Chapter 11 filing]]>http://www.engadget.com/2012/01/04/kodak-rumor-chapter-11-bankruptcy-nyse-delisted/http://www.engadget.com/2012/01/04/kodak-rumor-chapter-11-bankruptcy-nyse-delisted/http://www.engadget.com/2012/01/04/kodak-rumor-chapter-11-bankruptcy-nyse-delisted/#commentsTough to smile in times like these, folks. Barely three years after yet another staple in the photography business filed for Chapter 11, Kodak is reportedly getting its paperwork in order to do the same. The Wall Street Journal has it that bankruptcy protection is looking all the more likely in the coming weeks, as its efforts to hawk a "trove" of digital patents proved to be in vain. As it stands, the employer of around 19,000 is currently working with lenders to secure around $1 billion in debtor-in possession financing to keep it alive during the actual bankruptcy process. Should this all pan out, its portfolio of 1,100 patents would then be re-listed via a court-supervised bankruptcy auction. Oh, and to make matters worse, it warned earlier in the week that it could be delisted from the New York Stock Exchange after Kodak shares closed at under $1 for thirty straight trading days.

The Kodak Moment it never wanted: company reportedly prepping for Chapter 11 filing originally appeared on Engadget on Wed, 04 Jan 2012 14:51:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bankruptcybankruptcy protectionBankruptcyProtectionbusinesschapter 11Chapter11delistedfailfailureindustrykodakstockWed, 04 Jan 2012 14:51:00 EST<![CDATA[Kodak's Document Print app means never visiting the girl from the Xerox place]]>http://www.engadget.com/2011/12/06/kodaks-document-print-app-means-never-visiting-the-girl-from-th/http://www.engadget.com/2011/12/06/kodaks-document-print-app-means-never-visiting-the-girl-from-th/http://www.engadget.com/2011/12/06/kodaks-document-print-app-means-never-visiting-the-girl-from-th/#comments
Printing on the road usually leaves you at the mercy of your local Kinkos FedEx Office, but as long as you've got one of Kodak's cloud-print enabled Hero printers, you can avoid getting gouged. The company's just released an Android app that lets you print nearly everything, even webpages as long as they're accessed from the baked-in browser -- provided that you've left your home printer switched on. You can pull it down for free from the Android market from today and if you're interested, head on past the break for an unusually terse press release from the company.

Continue reading Kodak's Document Print app means never visiting the girl from the Xerox place

Kodak's Document Print app means never visiting the girl from the Xerox place originally appeared on Engadget on Tue, 06 Dec 2011 19:01:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>AndroidCloud PrintingcloudprintCloudPrintingDropboxEvernoteExcelGoogleGoogle Cloud PrintGoogle DocsGoogle DocumentsGoogleCloudPrintGoogleDocsGoogleDocumentsKodakKodak HeroKodakHeroMicrosoft ExcelMicrosoft OfficeMicrosoft WordMicrosoftExcelMicrosoftOfficeMicrosoftWordPowerPointPrintersPrintingWordTue, 06 Dec 2011 19:01:00 EST<![CDATA[Kodak's Waterproof Playfull records your pool parties in 720p, lets you relive that belly flop]]>http://www.engadget.com/2011/10/01/kodaks-waterproof-playfull-records-your-pool-parties-in-720p-l/http://www.engadget.com/2011/10/01/kodaks-waterproof-playfull-records-your-pool-parties-in-720p-l/http://www.engadget.com/2011/10/01/kodaks-waterproof-playfull-records-your-pool-parties-in-720p-l/#comments

Do you like to play rough? Good, then this Kodak's for you. Up for pre-order on the imaging company's website, is an update to the Playfull we got eyes-on with at CES earlier this year -- except this handheld camera's waterproof, as well as dustproof and drop-proof (although, only "onto plywood"). The slim 720p shooter weighs in at about 85 grams and sports a 2-inch LCD display, HDMI out, pop-out USB 2.0 and an SD card slot expandable up to 32GB. Kodak's offering this pocket and pool-friendly portable in mid to late October with a premium $120 price tag set for the black version, and the white at a lesser $100. If your high-end smartphone's just not cutting the HD-recording mustard, go ahead and hit up that source link below.

Kodak's Waterproof Playfull records your pool parties in 720p, lets you relive that belly flop originally appeared on Engadget on Sat, 01 Oct 2011 07:17:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>720p720pCamcordercameracamerasDropProofdustproofhandheldHD videohd video recordingHdVideoHdVideoRecordingKodakKodak PlayfullKodak Playfull waterproofKodakPlayfullKodakPlayfullWaterproofplayboySat, 01 Oct 2011 07:17:00 EST<![CDATA[Kodak dons cape for a Google Cloud Print-compatible Hero all-in-one printers]]>http://www.engadget.com/2011/09/08/kodak-dons-cape-for-a-google-cloud-print-compatible-hero-all-in/http://www.engadget.com/2011/09/08/kodak-dons-cape-for-a-google-cloud-print-compatible-hero-all-in/http://www.engadget.com/2011/09/08/kodak-dons-cape-for-a-google-cloud-print-compatible-hero-all-in/#comments Looks like HP will be getting some company in Google's print cloud. Kodak today announced a new line of Cloud Print-friendly all-in-one devices, which let users print documents without all of those pesky cords. The imaging company is rolling the Hero 3.1, 5.1, 6.1, 7.1 and 9.1. The low-end 3.1 features a 2.4-inch display and does printing, scanning, and copying for $99, while the top of the line 9.1 adds faxing, a 4.3-inch display, a 30 page automatic document feeder, automatic two-sided printing and Smart Sensor technology to the mix at $249. The $199 6.1, meanwhile, is the most business-minded of the bunch, with its home office networking capabilities. All of the models will be available this month. Printable press info after the break.

Continue reading Kodak dons cape for a Google Cloud Print-compatible Hero all-in-one printers

Kodak dons cape for a Google Cloud Print-compatible Hero all-in-one printers originally appeared on Engadget on Thu, 08 Sep 2011 02:10:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>all-in-one printerAll-in-onePrintercloud printCloudPrintgooglegoogle cloud printGoogleCloudPrintheroHero 3.1Hero 5.1Hero 6.1Hero 7.1Hero 9.1Hero3.1Hero5.1Hero6.1Hero7.1Hero9.1kodakkodak heroKodakHeroprinterThu, 08 Sep 2011 02:10:00 EST<![CDATA[Kodak shopping its IP wares, looks to cash in on the patent buying craze]]>http://www.engadget.com/2011/08/18/kodak-shopping-its-ip-wares-looks-to-cash-in-on-the-patent-buyi/http://www.engadget.com/2011/08/18/kodak-shopping-its-ip-wares-looks-to-cash-in-on-the-patent-buyi/http://www.engadget.com/2011/08/18/kodak-shopping-its-ip-wares-looks-to-cash-in-on-the-patent-buyi/#comments Pssssst... wanna buy some Kodak patents? The venerable photography firm has decided to unload a fair chunk of its IP -- 1,100 patents, give or take -- to boost its bottom line. You see, Kodak's got cash flow problems, and it thinks selling a portion of its portfolio is part of the solution. The company must've seen dollar signs after Nortel made a mint selling its patents, as Kodak's now marketing its IP merchandise using the same firm that helped Nortel do its record deal. Strong move Kodak, now if you can just settle up with Apple and RIM, you'll really be in the money.

Kodak shopping its IP wares, looks to cash in on the patent buying craze originally appeared on Engadget on Thu, 18 Aug 2011 08:52:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>eastman kodakEastmanKodakintellectual propertyIntellectualPropertyipkodakpatentpatentssalesellingThu, 18 Aug 2011 08:52:00 EST<![CDATA[ITC patent ruling against Apple will stand, Kodak nods approvingly]]>http://www.engadget.com/2011/07/19/itc-patent-ruling-against-apple-will-stand-kodak-nods-approving/http://www.engadget.com/2011/07/19/itc-patent-ruling-against-apple-will-stand-kodak-nods-approving/http://www.engadget.com/2011/07/19/itc-patent-ruling-against-apple-will-stand-kodak-nods-approving/#comments
July is shaping up to be a pretty good month for Kodak. Just a few weeks after granting the camera-maker a second wind in its ongoing patent battle against Apple and RIM, the ITC has issued yet another decision in its favor, determining that a May ruling against Cupertino will stand. At issue is an Apple complaint, filed in April 2010, charging Kodak with infringement of two patents on image processing and power management. On May 12, ITC Judge Robert Rogers shot down Apple's attack, ruling that the patents were not infringed and that one of them was invalid. The full Court had been scheduled to review Rogers' decision later this year, but that won't be happening, now that the ITC has decided to close the investigation (see the PDF, below). Kodak was understandably pleased with the result, though its focus will now turn to August 30th, when an administrative law judge is expected to weigh in on the company's patent offensive against both RIM and Apple.

ITC patent ruling against Apple will stand, Kodak nods approvingly originally appeared on Engadget on Tue, 19 Jul 2011 05:40:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>applebusinesscourtdecisionimage processingImageProcessinginfringementinternational trade commissionInternationalTradeCommissionITCjudgekodaklawsuitmoneypatentpatent infringementpatent warPatentInfringementPatentWarprocessingreviewRIMrulingTue, 19 Jul 2011 05:40:00 EST<![CDATA[Kodak granted reprieve in its ITC battle with Apple and RIM]]>http://www.engadget.com/2011/07/02/kodak-granted-reprieve-in-its-itc-battle-with-apple-and-rim/http://www.engadget.com/2011/07/02/kodak-granted-reprieve-in-its-itc-battle-with-apple-and-rim/http://www.engadget.com/2011/07/02/kodak-granted-reprieve-in-its-itc-battle-with-apple-and-rim/#comments Kodak scored a small victory this week in its International Trade Commission (ITC) case against Apple and RIM for their devices' infringement of Kodak's patent on picture previews. Back in January, an ITC administrative law judge (ALJ) made an initial determination that the patent was invalid and that iPhones and Blackberrys don't infringe Kodak's IP. After reviewing the decision per the parties' request, the Commission changed a few of the ALJ's patent claim interpretations and remanded the case for fresh analysis regarding both infringement and validity. Kodak, naturally, is painting the remand as a victory, even going so far as issuing a celebratory press release. Such swagger seems a bit premature, however, as the judge could once again find in favor of the crowds from Cupertino and Waterloo. The next Kodak moment isn't until August 30th, when the ALJ is due to render his ruling. Stay tuned.

Brian Heater contributed to this post.

Kodak granted reprieve in its ITC battle with Apple and RIM originally appeared on Engadget on Sat, 02 Jul 2011 01:41:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>appleblackberryinfringementinternational trade comissionInternationalTradeComissioniphoneitckodaklawsuitlegalpatentpatent infringementPatentInfringementrimSat, 02 Jul 2011 01:41:00 EST<![CDATA[Rugged gadgets put to the test in Engadget labs, wanton destruction ensues]]>http://www.engadget.com/2011/07/01/rugged-gadgets-put-to-the-test-in-engadget-labs-wanton-destruct/http://www.engadget.com/2011/07/01/rugged-gadgets-put-to-the-test-in-engadget-labs-wanton-destruct/http://www.engadget.com/2011/07/01/rugged-gadgets-put-to-the-test-in-engadget-labs-wanton-destruct/#comments Rugged Gadgets Lets be honest, we've all had those moments where we've wanted to hit our phone with a hammer or throw our laptop against the wall. Generally though, we resist those urges, knowing full well that it would spell the end for our precious gadget. There's a special class of rugged devices though, that are designed to withstand anything you throw at it -- or throw it at, as the case may be. We took a few of these beefy products, as well as one Extreme Sleeve for your non-military grade electronics, and put them through a battery of tests that would turn your average gadget into an unrecognizable pile of silicon and plastic. Head on after the break for a dose of dramatic destruction porn and to find out how this bevy of brawny portables held up against our gratuitous onslaught.

Continue reading Rugged gadgets put to the test in Engadget labs, wanton destruction ensues

Rugged gadgets put to the test in Engadget labs, wanton destruction ensues originally appeared on Engadget on Fri, 01 Jul 2011 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>casiocasio gzoneCasio gzone commandocasio playsport zx5CasioGzoneCasioGzoneCommandoCasioPlaysportZx5cf-31engadget laboratoriesengadget labsengadget showEngadgetLaboratoriesEngadgetLabsEngadgetShowextreme sleeveExtremeSleeveg-formG-Form Extreme SleeveG-formExtremeSleevegzonegzone commandoGzoneCommandoiosafeioSafe Rugged Portableiosafe rugged portable SSDIosafeRuggedPortableIosafeRuggedPortableSsdkodakpanasonicpanasonic toughbookpanasonic toughbook cf-31PanasonicToughbookPanasonicToughbookCf-31playsportplaysport zx5PlaysportZx5Poron XRDPoronXrdruggedtoughbooktoughbook cf-31ToughbookCf-31verizonvideoFri, 01 Jul 2011 17:00:00 EST<![CDATA[ITC judge rules against Apple in patent infringement case, Kodak smiles]]>http://www.engadget.com/2011/05/13/itc-judge-rules-against-apple-in-patent-infringement-case-kodak/http://www.engadget.com/2011/05/13/itc-judge-rules-against-apple-in-patent-infringement-case-kodak/http://www.engadget.com/2011/05/13/itc-judge-rules-against-apple-in-patent-infringement-case-kodak/#comments The International Trade Commission has weighed in on one half of the ongoing Apple-Kodak legal saga, ruling in favor of the team from Rochester. In a decision handed down yesterday, ITC Judge Robert Rogers determined that Apple's allegations of patent infringement are unfounded, adding that one of the company's patents is invalid. At issue are two digital camera technologies owned by Apple. One allows a camera to process multiple photos at the same time, while the other enables users to simultaneously adjust an image's balance, color and resolution. Apple claimed that Kodak illegally used these mechanisms in its Z-series, M-series, C-series, and Slice cameras, in addition to some video cameras. Judge Rogers clearly disagreed, though he won't be able to publicly explain his reasoning until both sides have had enough time to review confidential documents. Rogers' decision will also be subject to review by the full ITC, which is expected to issue a yea or nay on September 19th. A Kodak spokesman said the company is understandably "pleased" by the decision, but it won't have much time to rest on its laurels. On May 23rd, the ITC will announce a decision in a patent lawsuit that Kodak filed against both Apple and RIM, way back in January 2010. Stay tuned.

ITC judge rules against Apple in patent infringement case, Kodak smiles originally appeared on Engadget on Fri, 13 May 2011 08:46:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Applecourtdigital cameraDigitalCameraimageintellectual propertyIntellectualPropertyinternational trade commissionInternationalTradeCommissionitcjudgesKodakkodak c-serieskodak m-seriesKODAK SLICEkodak z-seriesKodakC-seriesKodakM-seriesKodakSliceKodakZ-serieslawlawsuitpatentpatent infringementPatentInfringementrulingFri, 13 May 2011 08:46:00 EST<![CDATA[Switched On: Flip-flops]]>http://www.engadget.com/2011/04/17/switched-on-flip-flops/http://www.engadget.com/2011/04/17/switched-on-flip-flops/http://www.engadget.com/2011/04/17/switched-on-flip-flops/#commentsEach week Ross Rubin contributes Switched On, a column about consumer technology.

This week's announcement that Cisco is shuttering its Flip Video business was but the latest twist in the history of the market share-leading device. The Flip got its start after its creator, Pure Digital, modified its original disposable camcorder to be reusable after hackers showed it could be done. And its success continued to defy convention that the product would resonate against a slew of digital cameras and increasingly competent smartphones that could shoot competitive -- and even high definition -- video.

The Flip also soared above the market share of companies with far stronger brands such as Sony and Kodak, although the latter made gains on a string of hits, including the 1080p-shooting Zi8 and waterproof PlaySport. It even fought back an initial foray from Apple's iPod nano and was still holding its own after the debut of the latest iPod touch, which took the HD video capture feature from the iPhone and made it available without a contract. Yes, the Flip hung tough. That's why its cancellation says volumes about Cisco, the company that acquired it for some $590 million in stock.

Cisco needed to show growth with a consumer product line that could not be easily augmented with acquisitions and that derived little connection with the mother brand -- even less than Linksys, the company's networking line. Cisco certainly tried. But the Flip group made a few false moves that stuck out like a pop-out USB connector, and with little of that spring-loaded joy.

Continue reading Switched On: Flip-flops

Switched On: Flip-flops originally appeared on Engadget on Sun, 17 Apr 2011 20:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Bloggie TouchBloggieTouchcamcorderCiscocolumnFlipFlip Slide HDFlip SlideHDFlip VideoFlipShareFlipShareTVFlipSlideHdFlipVideoKodakPlayTouchpocket camcorderPocketCamcorderPure DigitalPureDigitalRoss RubinRossRubinSlideHDSonySwitched OnSwitchedOnSun, 17 Apr 2011 20:15:00 EST<![CDATA[Kodak and Apple win early victories at International Trade Commission, big bucks hang in the balance]]>http://www.engadget.com/2011/03/26/kodak-and-apple-win-early-victories-at-international-trade-commi/http://www.engadget.com/2011/03/26/kodak-and-apple-win-early-victories-at-international-trade-commi/http://www.engadget.com/2011/03/26/kodak-and-apple-win-early-victories-at-international-trade-commi/#comments Looks like the US International Trade Commission's had a busy week in tech, as Bloomberg reports the organization has ruled on two longstanding patent wars involving Apple, Nokia, RIM and Kodak. While neither is out of the woods quite yet, two companies have reason to be pleased: Apple and Kodak. ITC Judge E. James Gildea ruled that five Nokia patents don't apply to Apple products, making a ban on iDevice importation unlikely in the United States, and the commission has also agreed to reconsider Kodak's case against Apple and RIM (regarding camera image previews) with its full six members present. Since nobody likes having their products seized at customs, even such preliminary verdicts can lead to large cash sums being paid out, and Kodak thinks it's found a whopper here -- Bloomberg reports that Kodak received a total of $964 million in licensing fees from Samsung and LG, and the company thinks it can suck $1 billion out of its latest pair of defendants. We'll let you know how it goes down.

Kodak and Apple win early victories at International Trade Commission, big bucks hang in the balance originally appeared on Engadget on Sat, 26 Mar 2011 16:01:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>AppledecisioninfringementInternational Trade ComissionInternationalTradeComissionITCKodaklawlawsuitlegalNokiapatentpatent infringementPatentInfringementpatentspreliminaryRIMverdictSat, 26 Mar 2011 16:01:00 EST<![CDATA[Kodak slips out Easyshare Max camera with 30x optical zoom, '3-step sharing']]>http://www.engadget.com/2011/01/04/kodak-slips-out-easyshare-max-camera-with-30x-optical-zoom-3-s/http://www.engadget.com/2011/01/04/kodak-slips-out-easyshare-max-camera-with-30x-optical-zoom-3-s/http://www.engadget.com/2011/01/04/kodak-slips-out-easyshare-max-camera-with-30x-optical-zoom-3-s/#comments
We're not quite sure why it wasn't part of the trio of Easyshare announcements earlier today, but Kodak has also rather quietly slipped out its new Easyshare Max camera, which is apparently the "world's only camera with 3-step sharing" (apart from the other just-announced Easyshare point-and-shoots, that is). In other more meaningful specs, the camera also packs an impressive 30x optical zoom with optical image stabilization, a 12 megapixel backside illuminated sensor, a 3-inch HVGA LCD and EVF 'round back, and full 1080p video recording. Look for this one to start shipping on March 9th for $330.

Kodak slips out Easyshare Max camera with 30x optical zoom, '3-step sharing' originally appeared on Engadget on Tue, 04 Jan 2011 21:54:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-step sharing3-stepSharingcesces 2011ces2011easyshareeasyshare maxEasyshareMaxkodakkodak easyshareKodakEasysharemaxTue, 04 Jan 2011 21:54:00 EST<![CDATA[Kodak adds Quick Comment option, activity sensor to refreshed Pulse digiframe]]>http://www.engadget.com/2011/01/04/kodak-adds-quick-comment-option-activity-sensor-to-refreshed-pu/http://www.engadget.com/2011/01/04/kodak-adds-quick-comment-option-activity-sensor-to-refreshed-pu/http://www.engadget.com/2011/01/04/kodak-adds-quick-comment-option-activity-sensor-to-refreshed-pu/#comments We've been talking a lot about second generation hardware at CES this year, but it's not just Intel and AMD who are unveiling their next iterative step toward consumers' pockets. Kodak has disclosed plans to update its Pulse digital photo frame -- you know, the one that can receive images via its very own email address -- with a new Quick Comments feature plus an activity sensor that switches the display off when no humanoids are moving about in front of it. It doesn't seem like you'll be able to author your own comments when responding to the sender of your latest pic, though you will be able to communicate via a selection of gorgeous pre-canned proclamations like the always popular "OMG!" and the ever-versatile "LOL!" The new Pulse will be arriving in the spring, costing $130 for the 7-inch variety or $200 for its 10-inch SKU. Skip past the break for the full press release.

Continue reading Kodak adds Quick Comment option, activity sensor to refreshed Pulse digiframe

Kodak adds Quick Comment option, activity sensor to refreshed Pulse digiframe originally appeared on Engadget on Tue, 04 Jan 2011 08:32:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2011activity sensorActivitySensorcesces 2011ces2011commentcommentsdigiframedigital frameDigitalFrameframekodakkodak pulseKodakPulsephoto framePhotoFramepulsequick commentQuickCommentTue, 04 Jan 2011 08:32:00 EST<![CDATA[Kodak intros Easyshare Touch, Mini and Sport cameras, Playfull and Playsport camcorders]]>http://www.engadget.com/2011/01/04/kodak-intros-easyshare-touch-mini-and-sport-cameras-playfull-a/http://www.engadget.com/2011/01/04/kodak-intros-easyshare-touch-mini-and-sport-cameras-playfull-a/http://www.engadget.com/2011/01/04/kodak-intros-easyshare-touch-mini-and-sport-cameras-playfull-a/#comments Things are just getting underway here at CES in Las Vegas, and Kodak's on-hand in order to serve up its latest smorgasbord of optical treasures. Without further ado, allow us to present to you the Easyshare Touch -- a $149.95 offering with a three-inch capacitive touchpanel, a dedicated video record button, a 14 megapixel sensor, 5x Schneider-Kreuznach lens and an HDMI output. Next up is the $99.95 Easyshare Mini, described as Kodak's smallest camera yet. It's "around the size of a credit card," offering a 3x wide-angle optical zoom lens, a built-in front mirror (you know, for those glorious self-portrait sessions), a ten megapixel sensor and a 2.5-inch rear LCD. Moving right along, there's the $79.95 Easyshare Sport, which is the outfit's first waterproof camera that can go up to ten feet underwater without any significant consequences. It'll also shrug off dirt and dust while snapping 12 megapixel shots and previewing them on the 2.4-inch LCD. Sashaying over to the video realm, there's the $149.95 Playfull camcorder, which touts an ultraslim design (it'll "fit in the pocket of your skinny jeans," according to Special K), a 1080p capture mode and an unmistakable 'Share' button to get your footage onto YouTube or a social network without any wasted time.

The company's also using CES as an opportunity to launch the next generation of its Playsport video camera, with this $179.95 model being waterproof up to ten feet, shockproof, dustproof and capable of logging clips at 1080p. You can also snap stills at five megapixels, and that previously mentioned 'Share' button is predictably tacked on here as well. Speaking of revisions, the Pulse digital photo frame is also seeing a gentle refresh, with this one available in 7-inch ($129.95) and 10-inch ($199.95) sizes. The newcomers add the ability to comment on the pictures you receive from friends and family, with our favorite predetermined response being "Such a KODAK MOMENT!" Seriously. Oh, and these also have an ingrained activity sensor that turns the frame off when you walk away, and brings it back to life when you re-approach. Finally, the ESP C310 all-in-one printer will be selling for $99.99, but so far as we can tell, Kodak would rather extol the virtues of its ink-saving abilities than drum up interest in its cutting-edge feature set. Further details can be spotted in the full release after the break.

Gallery: Kodak Easyshare Touch, Mini and Sport cameras, Playfull and Playsport camcorders at CES 2011


Gallery: Kodak's CES 2011 lineup hands-on

Continue reading Kodak intros Easyshare Touch, Mini and Sport cameras, Playfull and Playsport camcorders

Kodak intros Easyshare Touch, Mini and Sport cameras, Playfull and Playsport camcorders originally appeared on Engadget on Tue, 04 Jan 2011 00:02:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3-step sharing3-stepSharingcamcordercameracesces 2011Ces2011compact cameraCompactCameradigicamdigiframedigital cameradigital photo frameDigitalCameraDigitalPhotoFrameeasyshareEASYSHARE MINIEASYSHARE SPORTeasyshare touchEasyshareMiniEasyshareSportEasyshareTouchESP C310EspC310KodakKODAK PLAYSPORTKodakPlaysportphoto framePhotoFramePLAYFULLpoint and shootPointAndShootprinterPULSEsharesharingThe new KODAK EASYSHARE TOUCH CameraTheNewKodakEasyshareTouchCameratwittervideo cameraVideoCameraTue, 04 Jan 2011 00:02:00 EST<![CDATA[Kodachrome film is seriously at the end of its life -- again]]>http://www.engadget.com/2010/12/31/kodachrome-film-is-seriously-at-the-end-of-its-life-again/http://www.engadget.com/2010/12/31/kodachrome-film-is-seriously-at-the-end-of-its-life-again/http://www.engadget.com/2010/12/31/kodachrome-film-is-seriously-at-the-end-of-its-life-again/#comments Kodachrome film is iconic enough that there have now been several 'goodbye, Kodachrome' news stories, and we just couldn't resist one more. This time, our tale is of Dwayne's Photo in Parsons, Kansas (which we've had occasion to reference once before), a film processing store which has the distinction of being the final place to accept Kodachrome for development. The problem? The store has been flooded with packages of undeveloped film from all over the world as the window for its processing comes to an end. It turns out that having that distinction will get you hundreds of rolls of film a day, and Dwayne's Photo said that it would not process any films that arrived after Thursday. Yes, that was yesterday, though the mail is undoubtedly still arriving.

Kodachrome film is seriously at the end of its life -- again originally appeared on Engadget on Fri, 31 Dec 2010 13:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>cameracamerasfilmkodachromeKODACHROME FilmKodachromeFilmkodakFri, 31 Dec 2010 13:45:00 EST<![CDATA[Kodak Pulse email-to-photo-frame system down for days, millions of memories trapped in the cloud (updated)]]>http://www.engadget.com/2010/12/28/kodak-pulse-email-to-photo-frame-system-down-for-days-millions/http://www.engadget.com/2010/12/28/kodak-pulse-email-to-photo-frame-system-down-for-days-millions/http://www.engadget.com/2010/12/28/kodak-pulse-email-to-photo-frame-system-down-for-days-millions/#comments We definitely know quite a few people (including this very editor!) who bought their parents Kodak Pulse WiFi photo frames over the holidays, since they seem like a perfect way to share pictures without any fuss -- you can just email the frame directly. Unfortunately, it seems like this cloud service has a dark, dark lining: Kodak's backend email servers have been down since at least Christmas Eve, rendering the Pulse's most interesting feature essentially useless. What's worse, that status display above is more or less buried on the Pulse web site, so it's not even immediately clear that the problem is on Kodak's side -- and when things turn back on we're guessing more than one Pulse owner will find tons of duped photos on their frames from multiple email attempts, since the system doesn't confirm email receipt. We've heard a few anecdotal stories about email photo delivery slowing down / stopping during previous high traffic periods, so you'd think Kodak would have sorted this out by now, but we guess not -- we'll let you know when the company tells us about a fix.

Update: Kodak emailed us to say things are working again -- here's the statement:
We experienced slower performance of the Pulse server over the holiday weekend due to much higher than anticipated volumes. This resulted in a delay of pictures that were emailed to the Pulse frame. We did immediately address this issue and any pictures consumers emailed have since been delivered. We apologize for the inconvenience this caused our customers. It is our goal to ensure a great experience for all Pulse owners.

Kodak Pulse email-to-photo-frame system down for days, millions of memories trapped in the cloud (updated) originally appeared on Engadget on Tue, 28 Dec 2010 11:13:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>digital photo frameDigitalPhotoFramedowndown timeDownTimeemail to frameEmailToFramekodakkodak pulseKodakPulsephoto framePhotoFramepulsewifiwifi photo frameWifiPhotoFrameTue, 28 Dec 2010 11:13:00 EST<![CDATA[Target rolls out 'social network connectivity' at its Kodak kiosks, Sorkin furiously prepping script]]>http://www.engadget.com/2010/10/20/target-rolls-out-social-network-connectivity-at-its-kodak-kios/http://www.engadget.com/2010/10/20/target-rolls-out-social-network-connectivity-at-its-kodak-kios/http://www.engadget.com/2010/10/20/target-rolls-out-social-network-connectivity-at-its-kodak-kios/#comments Target's just announced that, effective immediately, most of its stores nationwide now offer social network connectivity at its Kodak Picture Kiosks. What does this mean for you, dear Target consumer? Well, it means you can now head over to Target and log into Facebook (or your Kodak Gallery account) and print photos directly from there -- if you can find anything worth actually printing, of course. Can you imagine anything better than casually printing out a few years' worth of photos of yourself making the KISS face on New Years' Eve while shopping for Michael Graves-designed tchotchkes? We can't. Press release (which you could print out if you really wanted to) is below.

Continue reading Target rolls out 'social network connectivity' at its Kodak kiosks, Sorkin furiously prepping script

Target rolls out 'social network connectivity' at its Kodak kiosks, Sorkin furiously prepping script originally appeared on Engadget on Wed, 20 Oct 2010 15:35:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>facebookkodakkodak kioskKodakKioskonline photosOnlinePhotosphoto printingPhotoPrintingphotosprintingsocialsocial networksocial networkingSocialNetworkSocialNetworkingtargetWed, 20 Oct 2010 15:35:00 EST<![CDATA[PYNK smart system could make those Kodak print kiosks useful (video)]]>http://www.engadget.com/2010/09/20/pynk-smart-system-finally-makes-those-kodak-print-kiosks-useful/http://www.engadget.com/2010/09/20/pynk-smart-system-finally-makes-those-kodak-print-kiosks-useful/http://www.engadget.com/2010/09/20/pynk-smart-system-finally-makes-those-kodak-print-kiosks-useful/#comments Just because film is dead doesn't mean that companies are at a loss for schemes to profit in the digital age. Take Kodak's PYNK smart print system as the perfect case study. Consumers buy PYNK branded photo frames and mats at $15 and $4 a pop, respectively. They then scan the goods into one of Kodak's 100,000 imaging kiosks and the machine will print photos (at further cost) into a perfectly cropped, sized, and aligned collage suitable for framing. A pretty smart solution for craft-less dummies like us.

Continue reading PYNK smart system could make those Kodak print kiosks useful (video)

PYNK smart system could make those Kodak print kiosks useful (video) originally appeared on Engadget on Mon, 20 Sep 2010 03:56:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>collageframekioskkodakmatphotokinaphotokina 2010Photokina2010pynkvideoMon, 20 Sep 2010 03:56:00 EST<![CDATA[Engadget's back to school guide: Printers]]>http://www.engadget.com/2010/09/03/engadgets-back-to-school-guide-printers/http://www.engadget.com/2010/09/03/engadgets-back-to-school-guide-printers/http://www.engadget.com/2010/09/03/engadgets-back-to-school-guide-printers/#commentsWelcome to Engadget's Back to School guide! We know that this time of year can be pretty annoying and stressful for everyone, so we're here to help out with the heartbreaking process of gadget buying for the school-aged crowd. Today, we've got printers in our sights -- and you can head to the Back to School hub to see the rest of the product guides.
Even if your textbooks, your movies, your music, and the photographic evidence of your quasi-legal sorority hazing exists purely in the digital domain, you'll have to print out things like term papers and court documents sooner or later. (Thought we forgot about that hazing, didn't you?) We know that's money tight, so we've found something to suit every budget. Now, on to the printers...

Continue reading Engadget's back to school guide: Printers

Engadget's back to school guide: Printers originally appeared on Engadget on Fri, 03 Sep 2010 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2010all-in-oneback to schoolbacktoschoolcopierDeskJetesp officeEspOfficeF4480faxHPHP Deskjet All-in-One Printer F4480HP PhotosmartHP Photosmart Premium Fax eHpDeskjetAll-in-onePrinterF4480HpPhotosmartHpPhotosmartPremiumFaxEkodakKodak ESP Office 6150KodakEspOffice6150Photosmart Premium FaxPhotosmartPremiumFaxprinterFri, 03 Sep 2010 13:30:00 EST<![CDATA[Kodak PlayTouch preview]]>http://www.engadget.com/2010/09/03/kodak-playtouch-preview/http://www.engadget.com/2010/09/03/kodak-playtouch-preview/http://www.engadget.com/2010/09/03/kodak-playtouch-preview/#comments While Sony's new Bloggie Touch provides the template for how simple and easy a touchscreen camcorder could really be, Kodak's similarly well built and attractive PlayTouch provides a stark contrast, with a modicum of simplicity on the surface, but a megaton of functionality to uncover. The PlayTouch isn't as pick-up-and go as the Bloggie, but the basic touchscreen controls can be quickly mastered. What sets the PlayTouch apart are the in-depth features like an external microphone jack (complete with gain control), video effects (like black & white and sepia modes), and the particularly ambitious video editor. You can only trim shots and extract stills from that latter mode, but paired with the newer generation EasyShare functionality that lets you pre-assign photos and videos for upload to YouTube and Facebook, among other services, you can almost completely avoid using your computer as anything but a dumb pipe to the internet.

The PlayTouch really isn't a "gift it to your grandma" sort of camcorder; even with a $230 pricetag you still have to bring your own SD card, there's no built-in storage, and most of the higher end functionalities like the external audio jack will be lost on the general populace. Still, if you're looking for a pocket camcorder that is more than just a dumb pocket camcorder, Kodak seems to be continuing the niche it carved out for itself originally with the Zi8.

Gallery: Kodak PlayTouch preview

Kodak PlayTouch preview originally appeared on Engadget on Fri, 03 Sep 2010 10:21:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>camcordereasyshareimpressionskodakkodak playtouchKodakPlaytouchplaytouchpocket camcorderPocketCamcorderpreviewtouchscreentouchscreen cameraTouchscreenCameraFri, 03 Sep 2010 10:21:00 EST<![CDATA[Kodak's Playtouch 1080p pocket camcorder and EasyShare M590 announced]]>http://www.engadget.com/2010/08/23/kodaks-playtouch-1080p-pocket-camcorder-and-easyshare-m590-anno/http://www.engadget.com/2010/08/23/kodaks-playtouch-1080p-pocket-camcorder-and-easyshare-m590-anno/http://www.engadget.com/2010/08/23/kodaks-playtouch-1080p-pocket-camcorder-and-easyshare-m590-anno/#comments
Kodak just kicked out a pair of devices with its Playtouch pocket camcorder and EasyShare M590 point and shoot. Kodak's $229.95 Playtouch is capable of shooting image stabilized 1080p video with stereo audio to SDHC cards. A 3-inch capacitive touchscreen gives you plenty of room to edit your video (or extract a still) on camera before flipping out the USB arm for a quick PC transfer. Otherwise, an HDMI jack lets you pump that digital keepsake right to the living room television without the PC assist. Rounding things out are an external microphone jack and Share button that makes it easy to push those memories to YouTube or FaceBook, or send via email if that's your preference. Kodak's rather mundane $199.99 EasyShare M590 is being billed as the world's slimmest digital camera with 5x optical zoom. Otherwise, things simmer down with a 2.7-inch LCD, some kind of image stabilization, face recognition, unspecified HD video capture, and microSD card support. And as you'd expect, the M590 also features a Share button that makes tagging and uploading photos and video to social media sites like Facebook, Flickr, and YouTube a snap. M590 image and press releases after the break. Expect both cameras to ship sometime in the fall.

Continue reading Kodak's Playtouch 1080p pocket camcorder and EasyShare M590 announced

Kodak's Playtouch 1080p pocket camcorder and EasyShare M590 announced originally appeared on Engadget on Mon, 23 Aug 2010 01:33:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>camcordercameraeasyshareeasyshare m590EasyshareM590hdmikodakm590Playtouchpocket camcoderpocket camcorderPocketCamcoderPocketCamcordershareshare buttonShareButtonusbMon, 23 Aug 2010 01:33:00 EST<![CDATA[Final roll of Kodachrome processed in Kansas; angel sheds a rainbow-colored tear]]>http://www.engadget.com/2010/07/21/final-roll-of-kodachrome-processed-in-kansas-angel-sheds-a-rain/http://www.engadget.com/2010/07/21/final-roll-of-kodachrome-processed-in-kansas-angel-sheds-a-rain/http://www.engadget.com/2010/07/21/final-roll-of-kodachrome-processed-in-kansas-angel-sheds-a-rain/#comments
 Kodak stopped manufacturing the oldest film in its catalog last year, but Dwayne's Photo in Parsons, Kansas kept its Kodachrome processing rig around just in case. Last week photographer Steve McCurry processed the final manufactured roll of Kodachrome there - 33 frames taken around New York City, and three taken in Parsons. A crew from National Geographic (where McCurry made his name, specifically with the iconic "Afghan Girl" cover photo) documented the final roll's journey from the factory to processing, so you'll probably be able to find out more on it soon. Oh, and if grandma's a real shutterbug, you might want to tell her to check the attic for any spare Kodachrome rolls she has lying around -- Dwayne's is the last remaining Kodachrome processing facility in the world, and that service will stop on December 10th. Now, if it's quite alright -- pardon us while we attempt to capture a meaningful moment on our soulless Easyshare ecosystem of products.

Final roll of Kodachrome processed in Kansas; angel sheds a rainbow-colored tear originally appeared on Engadget on Wed, 21 Jul 2010 19:33:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>35mmcameradwayneseasysharefilmkansaskodachromekodakNational Geographicnational geographic channelNationalGeographicnew york cityNewYorkCityphotoprocessingretroripvintageWed, 21 Jul 2010 19:33:00 EST<![CDATA[Kodak PlaySport Zx3 waterproof HD camera review]]>http://www.engadget.com/2010/05/27/kodak-playsport-zx3-waterproof-hd-camera-review/http://www.engadget.com/2010/05/27/kodak-playsport-zx3-waterproof-hd-camera-review/http://www.engadget.com/2010/05/27/kodak-playsport-zx3-waterproof-hd-camera-review/#comments We have plenty of gripes with the current crop of pocket cameras, most of them to do with image quality: grainy footage, poor (laughable) low-light performance, a lack of autofocus, digital zoom, gimmicky 1080p, and so forth. The new Kodak PlaySport Zx3 HD Waterproof Video Camera solves none of those problems. But you can put it underwater. So, all is forgiven. Follow after the break for our full review.

Continue reading Kodak PlaySport Zx3 waterproof HD camera review

Kodak PlaySport Zx3 waterproof HD camera review originally appeared on Engadget on Thu, 27 May 2010 11:05:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>kodakkodak zx3KodakZx3playsportplaysport hdPlaysportHdpocket camcorderpocket cameraPocketCamcorderPocketCamerareviewvideowaterproofwaterproof camcorderwaterproof cameraWaterproofCamcorderWaterproofCamerazx3Thu, 27 May 2010 11:05:00 EST<![CDATA[Kodak Slice touchscreen camera, Pulse WiFi frame, and PlaySport pocket camcorder now on sale... at JC Penney]]>http://www.engadget.com/2010/04/01/kodak-slice-touchscreen-camera-pulse-wifi-frame-and-playsport/http://www.engadget.com/2010/04/01/kodak-slice-touchscreen-camera-pulse-wifi-frame-and-playsport/http://www.engadget.com/2010/04/01/kodak-slice-touchscreen-camera-pulse-wifi-frame-and-playsport/#comments We're not sure why Kodak is pushing its new Slice touchscreen camera out to JCPenney before any of the usual retail suspects, but there it is, looking radiant in "Radish" and marked up with a $100 premium over the usual $349 list price. If that doesn't make any sense to you, you can also grab the 14 megapixel shooter with the 3.5-inch display, 720p video capture, and built-in search for $349 from JR.com or Kodak. Kodak's also got the seven-inch Pulse WiFi digiframe that pulls photos from Facebook and the new PlaySport 1080p waterproof pocket camcorder up for sale now as well, at $129 and $149, respectively -- and yes, you can buy those from Penney's at a markup if you like, because the very fabric of our relationship to reality is unraveling in a heap on the floor of the Juniors department.

Kodak Slice touchscreen camera, Pulse WiFi frame, and PlaySport pocket camcorder now on sale... at JC Penney originally appeared on Engadget on Thu, 01 Apr 2010 13:11:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>camcordercameradigiframeframekodakon saleOnSaleplaysportpocket camcorderPocketCamcorderpulseslicetouchscreenwaterproofwifi digiframeWifiDigiframewireless digiframewireless digital photo frameWirelessDigiframeWirelessDigitalPhotoFrameThu, 01 Apr 2010 13:11:00 EST<![CDATA[Head-mounted webcam gets, records funny looks]]>http://www.engadget.com/2010/02/26/head-mounted-webcam-gets-records-funny-looks/http://www.engadget.com/2010/02/26/head-mounted-webcam-gets-records-funny-looks/http://www.engadget.com/2010/02/26/head-mounted-webcam-gets-records-funny-looks/#comments
We've all been there before -- you're an investigative journalist and you need some hidden camera footage of a rave or male model convention. Of course, we've seen plenty of wearable camcorders in the past, but none with that special something -- until now. This unnamed concept design by William Gerwin (and sponsored by Kodak) puts a 10.1 megapixel webcam, pico projector, and WiFi right where you never knew you needed 'em -- on your head. The designer envisions wireless connectivity and P2P support for the thing, but as of right now it looks like little more than a couple pieces of hardware super-glued to a nicer than most pair of headphones. If this thing ever becomes real, we'll let you know -- in the meantime, hit the source link to get a closer look.

Continue reading Head-mounted webcam gets, records funny looks

Head-mounted webcam gets, records funny looks originally appeared on Engadget on Fri, 26 Feb 2010 20:28:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>body wornBodyWorncameraconcepthead mounted cameraHeadMountedCameraheadphoneskodakprojectoryanko designYankoDesignFri, 26 Feb 2010 20:28:00 EST