Engadget http://www.engadget.com Engadget http://www.blogsmithmedia.com/www.engadget.com/media/feedlogo.gif Engadget http://www.engadget.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Elaborate Nike YouTube video has hidden Sonic Game (video)]]>http://www.engadget.com/2012/05/21/nike-youtube-video-has-hidden-sonic-game/http://www.engadget.com/2012/05/21/nike-youtube-video-has-hidden-sonic-game/http://www.engadget.com/2012/05/21/nike-youtube-video-has-hidden-sonic-game/#comments Elaborate Nike YouTube video has hidden Sonic Game (video)

When you've got a marketing budget the size of Nike's, a few international footballers and a glossy video aren't really enough. That's why its latest "My time is now" campaign is an all out interactive spend-fest, complete with a hidden Sega Sonic the Hedgehog mini-game. The standard YouTube version (as seen over the break) isn't interactive, but head over to Nike's official channel, and it's a whole different ball game. Clicking on players slow-mos the action, bringing up player details etc., and there are nine hidden "tunnels' to find -- one of which being the Sonic game. Can you find it? Hint: look for the pitch-side adverts with go faster boot on. Your time is now...

Continue reading Elaborate Nike YouTube video has hidden Sonic Game (video)

Elaborate Nike YouTube video has hidden Sonic Game (video) originally appeared on Engadget on Mon, 21 May 2012 01:42:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adverteaster eggEasterEggfootballhidden gameHiddenGameinteractive advertInteractiveAdvertnikenike footballnike promotionNikeFootballNikePromotionsegasonicsonic the hedgehogSonicTheHedgehogsportsportsvideoyoutubeMon, 21 May 2012 01:42:00 EST<![CDATA[Nike and Tom Sachs reach for the stars, create NikeCraft sportswear with space-grade materials]]>http://www.engadget.com/2012/05/17/nikecraft-tom-sachs-space-program-sportswear/http://www.engadget.com/2012/05/17/nikecraft-tom-sachs-space-program-sportswear/http://www.engadget.com/2012/05/17/nikecraft-tom-sachs-space-program-sportswear/#comments Image

Just because you're not an astronaut, it doesn't mean you can't dress yourself in clothes that are out of this world. Artist Tom Sachs recently teamed up with Nike to create a limited edition lineup of spacey sports clothing, dubbed NikeCraft, to coincide with his current Space Program project -- a rendition of a four-week trip to Mars. The company highlights that the roster was made with "materials that have never been used in sportswear," some of which has already made its way onto NASA's equipment for space-travel. As ecouterre points out, among what's on offer you'll find bags made from the Ortho fabric used on the outside of spacesuits to the Mars Yard shoe with Vectran fiber -- the same stuff from the airbags of the Mars Excursion Rover. There's nary a detail about pricing, but the goods will be available at various boutiques around the world and at Space Program: Mars while it's open through June 17th at New York City's Park Avenue Armory. Hit up the links below to gaze at all the details.

Just because you're not an astronaut doesn't mean that you can't dress yourself in clothes that are out of this world. Artist Tom Sachs recently teamed up with Nike to create a limited edition lineup of of spacey sports clothing, dubbed NikeCraft, to coincide with his current Space Program project -- a rendition of a four week trip to Mars. As ecouterre notes, the highlight of the pieces is that they're all manufactured (partially, at least) with materials used by NASA in its own equipment. Among what's on offer, you'll find bags made from the Ortho fabric used on the outside of spacesuits to the Mars Yard shoes with Vectran fabric -- the same stuff from the airbags of the Mars Excursion Rover. There's nary a detail about pricing, but the goods will be available at various boutiques around the world and at Space Program: Mars while it's open until Jun 17th inside of New York City's Park Avenue Armory. You'll find more details

Nike and Tom Sachs reach for the stars, create NikeCraft sportswear with space-grade materials originally appeared on Engadget on Thu, 17 May 2012 21:17:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>capsule collectionCapsuleCollectionclothinglimited editionLimitedEditionmarsmars roverMarsRovernasanikenikecraftouterspaceshoesspacespace program marsSpaceProgramMarsspacesuitTom Sachstom sachs space programTomSachsTomSachsSpaceProgramvectranThu, 17 May 2012 21:17:00 EST<![CDATA[Inhabitat's Week in Green: dinosaur robots, a robotic bee and X-ray origami animals]]>http://www.engadget.com/2012/02/26/dinosaur-robots-a-robotic-bee-an/http://www.engadget.com/2012/02/26/dinosaur-robots-a-robotic-bee-an/http://www.engadget.com/2012/02/26/dinosaur-robots-a-robotic-bee-an/#comments Each week our friends at Inhabitat recap the week's most interesting green developments and clean tech news for us -- it's the Week in Green.

This week researchers harnessed technology to reap groundbreaking discoveries in the natural world as Inhabitat reported that a team of Russian scientists revived a 32,000-year-old Arctic plant, and a 298-million-year-old-forest was discovered beneath a coal mine in China. Meanwhile Google geared up to launch a "sea view" service that lets anyone explore the Great Barrier Reef and Makerbot launched a line of colorful 3D printed shells for hermit crabs. Scientists also harnessed advanced printing technology to create a new breed of realistic dinosaur robots and a miniature self-assembling robotic bee, and the National academy of Sciences urged a review of the risks and safety of nanomaterials.

Green transportation also soared to astronomical new heights this week as a Japanese company announced plans to build a 20,000-mile-high space elevator by the year 2050. Back on earth, Toyota unveiled the first teaser shots of its upcoming FT-Bh mini hybrid vehicle, a "bricked" Tesla Roadster launched an electric vehicle debate, and we showcased the Taga -- the ultimate bike stroller combo. Green design also hit the slopes as Tenna, Switzerland took the wraps off the world's first solar wing-powered ski lift and William Hughes carved up the snow wearing a blazing bright LED snowboarding suit.

In other news, eco phone design rang loud and clear this week as AT&T announced plans to place green labels on mobile devices, Shikun Sun developed a DrawBraille smartphone for the blind, and a NYC architect turned defunct phone booths into free mini libraries. We were also wowed by several eye-opening recycled designs -- a fully functional twin lens reflex LEGO camera and a series of furnishings made from decommissioned military ammunition. Last but not least, we watched a gigantic solar-powered metal flower bloom in Buenos Aires, Nike created a prosthetic running sole for amputee triathletes, and we shined a light on Takayuki Hori's beautiful X-ray origami animals.

Inhabitat's Week in Green: dinosaur robots, a robotic bee and X-ray origami animals originally appeared on Engadget on Sun, 26 Feb 2012 20:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3dattgoogleinhabitatledmakerbotNikerobotsThisWeekInGreenWeekInGreenwilliam hughesWilliamHughesX-raySun, 26 Feb 2012 20:30:00 EST<![CDATA[New Nike+ apps and shoes cater to basketball players and training athletes]]>http://www.engadget.com/2012/02/22/new-nike-apps-and-shoes/http://www.engadget.com/2012/02/22/new-nike-apps-and-shoes/http://www.engadget.com/2012/02/22/new-nike-apps-and-shoes/#comments Nike Hyperdunk+Nike just keep building on its Nike+ brand, turning what started life as a glorified pedometer, into a full-fledged workout-tracking platform. Hot on the heels of the FuelBand comes Nike+ Basketball and Nike+ Training, two new experiences with their own dedicated footwear. For ballers, the Hyperdunk+ features a pressure sensor that measures speed, jump height and even abstract concepts like "hustle." It also features a ego Showcase mode that lets you superimpose workout data over video of you dunking and post it to the web. Nike+ Training, like almost every other workout app or digital accessory, turns getting in shape into a game. The app features a series of drills and challenges meant to improve speed, agility and strength, and your performance can be uploaded to a global leaderboard. The new apps and shoes, including the Hyper Workout+ for Women and the TR 1+ for men, will be available on June 29th in the US, UK, Germany, France and China. Head on after the break for one more image and PR.

Continue reading New Nike+ apps and shoes cater to basketball players and training athletes

New Nike+ apps and shoes cater to basketball players and training athletes originally appeared on Engadget on Wed, 22 Feb 2012 11:52:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>exerciseexercise trackingExerciseTrackingfitnessfitness trackingFitnessTrackinghyper workout plusHyperWorkoutPlusnikenike hyperdunk plusNike plusnike plus basketballnike plus trainingNikeHyperdunkPlusNikePlusNikePlusBasketballNikePlusTrainingTR 1 PlusTr1Plusworkoutworkout trackingWorkoutTrackingWed, 22 Feb 2012 11:52:00 EST<![CDATA[Nike+ FuelBand's internals get splayed at the FCC]]>http://www.engadget.com/2012/02/03/nike-fuelband-fcc/http://www.engadget.com/2012/02/03/nike-fuelband-fcc/http://www.engadget.com/2012/02/03/nike-fuelband-fcc/#comments
All of these wrist-mounted fitness gizmos are pretty nifty, but we always wonder how they get those rigid circuit boards into such an unsuitable form-factor. Well, thanks to those scalpel-happy boffins at the FCC's underground bunker, wonder no more. Nike's FuelBand was wheeled in on a trolley and torn (quite literally) to pieces, and we felt we just had to share the pictures with you. A long peruse of the user manual revealed that the two metal extender links (for bigger-wristed enthusiasts) have to be swapped out using a sizing tool -- but the manual notes that if one isn't to hand, a bent paperclip will suffice. The documents also revealed that it's using a TI CC2564 Bluetooth radio and a stack provided by Stonestreet One. The monopole antenna is etched directly into the substrate of the flexible circuit board -- ensuring it'll bend around your bones and still operate. We also learned that once connected to your cellphone, it'll sit in a low-power "sniff mode," for two minutes and if there's no further activity it'll shut down. Of course, what's interesting to you (and us, honestly) is all the pictures in the second gallery, so get looking!

Gallery: Nike+ Fuelband External Images


Gallery: Nike+ Fuelband Internal Images

Nike+ Fuelband Internal Images

Nike+ FuelBand's internals get splayed at the FCC originally appeared on Engadget on Fri, 03 Feb 2012 22:37:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>BluetoothBluetooth MonopoleBluetoothMonopoleCC2564cc2564 BluetoothCc2564BluetoothFCCFitnessFuel BandFuelBandNikeNike FuelBandNike plus FuelBandNike+Nike+ FuelbandNike+FuelbandNikeFuelbandNikePlusFuelbandStonestreet OneStonestreetOneTexas InstrumentsTexasInstrumentsTIFri, 03 Feb 2012 22:37:00 EST<![CDATA[The Nike+ FuelBand measures activity in NikeFuel, ready for your NikeLife]]>http://www.engadget.com/2012/01/19/nike-introduces-nikefuel-wristband/http://www.engadget.com/2012/01/19/nike-introduces-nikefuel-wristband/http://www.engadget.com/2012/01/19/nike-introduces-nikefuel-wristband/#comments While Nike might have beat competitors like the MotoACTV and Jawbone Up to the active bracelet market over two years ago, its original endeavor, the Nike+ SportBand, was getting long in the tooth. That changes today with the introduction of the far sleeker Nike+ FuelBand. It's much in the vein of the original, except boasts a more attractive 20 LED dot-matrix display and can measure activity in a new unit the company calls NikeFuel. That latter bit is a normalized score that unlike calories "awards equal points for the same activity regardless of physical makeup." We'll have to see about that, but we're definitively smitten with its design and that row of colorful LEDs that progressively fills as one gets closer to reaching their intended goal. The $149 pre-orders go live on the company's online store at 5PM ET, but those interested ought to peep the PR and video after the break.

Continue reading The Nike+ FuelBand measures activity in NikeFuel, ready for your NikeLife

The Nike+ FuelBand measures activity in NikeFuel, ready for your NikeLife originally appeared on Engadget on Thu, 19 Jan 2012 12:57:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fuelbandnikenike fuelnike fuelbandnike plusnike plus fuelbandnike plus nikefuelbandnike plus wristbandnikefuelnikefuelbandnikeplusnikeplus fuelbandNikePlusFuelbandNikePlusNikefuelbandNikePlusWristbandvideowirstbandThu, 19 Jan 2012 12:57:00 EST<![CDATA[Berg's Little Printer churns out RSS feeds with a receipt and a smile]]>http://www.engadget.com/2011/11/30/bergs-little-printer-churns-out-rss-feeds-with-a-receipt-and-a/http://www.engadget.com/2011/11/30/bergs-little-printer-churns-out-rss-feeds-with-a-receipt-and-a/http://www.engadget.com/2011/11/30/bergs-little-printer-churns-out-rss-feeds-with-a-receipt-and-a/#comments
It's hard to think of a device more aptly named than BergCloud's Little Printer. It's little. It prints. It even smiles at you. And why wouldn't it? It's adorable. Equally notable is what it produces -- RSS feeds printed out on grocery store-style receipts. All you have to do is hook it up to your router, configure your RSS subscriptions from your smartphone and press a button to print them out. The Little Printer connects wirelessly to a small box that's plugged into your router. This box, in turn, interfaces with the Berg Cloud (also unveiled this week), providing constant updates and pulling down any web content you've selected. If, for instance, you want to print out Foursquare updates, you can use the app to add them to your queue and print them out for later reading. It's basically like InstaPaper... with more paper. BergCloud has already struck partnerships with ARUP, Foursquare, The Guardian, Nike and Google, though more are on the way. No word yet on pricing, but the device is slated to go up for pre-order sometime next year. Check it out in action, after the break.

[Thanks, Dave]

Continue reading Berg's Little Printer churns out RSS feeds with a receipt and a smile

Berg's Little Printer churns out RSS feeds with a receipt and a smile originally appeared on Engadget on Wed, 30 Nov 2011 09:25:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>accessoryappARUPBergBerg CloudBerg Little PrinterBergCloudBergLittlePrintercloud computingCloudComputingFoursquareinstapaperlittle printerLittlePrinternikepaperperipheralprintprinterreceiptrouterRSSRSS feedRssFeedsmartphonesmilethe guardianTheGuardianvideoWed, 30 Nov 2011 09:25:00 EST<![CDATA[Nike unveils the 2011 MAG shoe, to auction off 1500 pairs of the coolest kicks in Hill Valley for charity]]>http://www.engadget.com/2011/09/08/nike-unveils-the-2011-mag-shoe-to-auction-off-1500-pairs-of-the/http://www.engadget.com/2011/09/08/nike-unveils-the-2011-mag-shoe-to-auction-off-1500-pairs-of-the/http://www.engadget.com/2011/09/08/nike-unveils-the-2011-mag-shoe-to-auction-off-1500-pairs-of-the/#comments You remember the first time you saw Back to the Future II, don't you? We all dreamed of a world filled with hoverboards and self-lacing shoes, and now Nike's made the latter a reality... sort of. Marty McFly's favorite high tops are now called the 2011 Nike MAGs and look just like the kicks in the movie, though it appears that you'll have to lace 'em up the old-fashioned way. They'll only be on sale during a ten-day period starting tonight at 8:30PM Pacific Standard Time, and no amount of flux-capacitation can score you a pair if you miss that window. 150 sets of shoes will be auctioned on eBay's Fashion Vault each day (sorry, US bidders only), and all the net proceeds will go to The Michael J. Fox Foundation to further Parkinson's research. Not only that, all the money made will be doubled through matching contributions. Nice job, Nike, now about those hoverboards...

Continue reading Nike unveils the 2011 MAG shoe, to auction off 1500 pairs of the coolest kicks in Hill Valley for charity

Nike unveils the 2011 MAG shoe, to auction off 1500 pairs of the coolest kicks in Hill Valley for charity originally appeared on Engadget on Thu, 08 Sep 2011 17:35:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2011 nike mag2011NikeMagback to the futureBackToTheFuturecharityebayebay fashion vaultEbayFashionVaultmarty mcflyMartyMcflymichael j foxmichael j fox foundationMichaelJFoxMichaelJFoxFoundationnikeparkinsonsparkinsons diseaseParkinsonsDiseaseshoeshoesvideoThu, 08 Sep 2011 17:35:00 EST<![CDATA[Nike teases Back to the Future shoes, creepily leaks the contents of Marty McFly's closet (video)]]>http://www.engadget.com/2011/09/08/nike-teases-back-to-the-future-shoes-creepily-leaks-the-content/http://www.engadget.com/2011/09/08/nike-teases-back-to-the-future-shoes-creepily-leaks-the-content/http://www.engadget.com/2011/09/08/nike-teases-back-to-the-future-shoes-creepily-leaks-the-content/#comments

What's this? Nike is rounding up shoe-nerds (and Back to the Future fans) to taunt them with futuristic metal shield glasses, 1980s candy, and a personal messages from Doc Brown? Could this shoe-filled YouTube tease (uploaded by DocEmmettBrown88) mean that Nike is bringing nerdom's coolest kicks back from the future? Probably. After all, you don't patent power-laces just to make a normal shoe, do you?

[Thanks, Rob]

Nike teases Back to the Future shoes, creepily leaks the contents of Marty McFly's closet (video) originally appeared on Engadget on Thu, 08 Sep 2011 00:53:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>autolacingback to the futureBackToTheFuturebttfhello mcflyHelloMcflykicksmarty mcflyMartyMcflymcflyminipostNikepatentpower lacesPowerLacesshoessneakersTennis ShoesTennisShoesvideowearablesThu, 08 Sep 2011 00:53:00 EST<![CDATA[Nike+ GPS social update may make people run from your Twitter, Facebook accounts]]>http://www.engadget.com/2011/07/09/nike-gps-social-update-may-make-people-run-from-your-twitter-f/http://www.engadget.com/2011/07/09/nike-gps-social-update-may-make-people-run-from-your-twitter-f/http://www.engadget.com/2011/07/09/nike-gps-social-update-may-make-people-run-from-your-twitter-f/#comments Nike this week rolled out updates to its Nike+ GPS app, including bug fixes and an auto-calibration feature, which should help improve the accuracy of your run. Also on-board are social features, which push running updates to Facebook and Twitter. The tweets / posts can thankfully be edited before being sent out into the world, but we'd recommend using a bit of discretion before loading up your feeds with the minutiae of your latest workout. The updated app can be downloaded now for $2 from iTunes.

Nike+ GPS social update may make people run from your Twitter, Facebook accounts originally appeared on Engadget on Sat, 09 Jul 2011 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>appappleexerciseiphonenikenike plusnike plus gpsNikePlusNikePlusGpsrunrunnerrunningSat, 09 Jul 2011 12:00:00 EST<![CDATA[Nike+ GPS data becomes art, exercise still exhausting]]>http://www.engadget.com/2011/04/29/nike-gps-data-becomes-art-exercise-still-exhausting/http://www.engadget.com/2011/04/29/nike-gps-data-becomes-art-exercise-still-exhausting/http://www.engadget.com/2011/04/29/nike-gps-data-becomes-art-exercise-still-exhausting/#comments
Need a new use for that Nike+ SportWatch GPS you dropped 200 clams on? Interactive media collective YesYesNo has transformed the SportWatch data -- you know, that pristine numerical representation of all your huffing, sweating, and hurting -- into something like art. Working at Nike's Innovation Labs, the group first sent runners out across the company's campus wearing the watches. Then, custom software combined GPS maps of their workouts with information about speed, distance, and acceleration to create an initial 3-D rendering. Finally, each runner could tweak textures and colors to create a customized print; some even had their designs laser etched on a custom shoe box. The software powering all this creativity is long way from commercialization, but is built on openFrameworks, so feel free to start hacking your data into beautiful, life-giving artwork. Or you could, you know, go for a jog.

Nike+ GPS data becomes art, exercise still exhausting originally appeared on Engadget on Fri, 29 Apr 2011 02:12:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>artNikenike plusnike plus sportwatch gpsNike+Nike+ GPSNike+ SportWatch GPSNike+GpsNike+SportwatchGpsNikePlusNikePlusSportwatchGpsrunningrunning shoesRunningShoesshoessportsSportWatch GPSSportwatchGpstomtomwatchwristwatchYesYesNoFri, 29 Apr 2011 02:12:00 EST<![CDATA[Engadget interviews Dwyane Wade: the technology behind the Fly Wade (video)]]>http://www.engadget.com/2011/04/09/engadget-interviews-dwyane-wade-the-technology-behind-the-fly-w/http://www.engadget.com/2011/04/09/engadget-interviews-dwyane-wade-the-technology-behind-the-fly-w/http://www.engadget.com/2011/04/09/engadget-interviews-dwyane-wade-the-technology-behind-the-fly-w/#comments
It's not all that difficult to peer at some gadgets without fully understanding the wizardry and magic that assists in driving them from concept to reality. Did shoes ever cross your noggin as being technologically eye-opening? Sure, a few pairs of kicks have caught our attention over the years, but could a pair of sneakers be more than just that? To answer that question, we sat down with NBA star Dwyane Wade and Jordan Brand designer Mark smith to figure out what goes in to a modern pair of kicks. Read on to introduce your brain to the latest in shoe technology.

Gallery: Engadget interviews Dwyane Wade: the technology behind the Fly Wade

Continue reading Engadget interviews Dwyane Wade: the technology behind the Fly Wade (video)

Engadget interviews Dwyane Wade: the technology behind the Fly Wade (video) originally appeared on Engadget on Sat, 09 Apr 2011 19:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>aj 2011Aj2011dwyanedwyane wadeDwyaneWadeflyfly wadeFlyWadeinterviewjordanjordan brandJordanBrandlightweightmarkmark smithMarkSmithnikeshoesmithsneakertechnologythe flashTheFlashvideowadewearablesSat, 09 Apr 2011 19:15:00 EST<![CDATA[Nike+ SportWatch GPS now on sale, $199 adds geek cred to your workout routine]]>http://www.engadget.com/2011/04/02/nike-sportwatch-gps-now-on-sale-199-adds-geek-cred-to-your-ro/http://www.engadget.com/2011/04/02/nike-sportwatch-gps-now-on-sale-199-adds-geek-cred-to-your-ro/http://www.engadget.com/2011/04/02/nike-sportwatch-gps-now-on-sale-199-adds-geek-cred-to-your-ro/#comments Wrist-mounted iPod nano not quite the running companion of which you'd originally dreamed? This Nike+ SportsWatch GPS will be happy to take its place. We spotted the TomTom-branded fitness watch at CES this year, and now it's formally on sale -- though unfortunately for a price far steeper than those of its immediate ancestors. Of course, the $199 band isn't just a replacement for the Nike+ iPod system, it also uses that onboard GPS to keep track of where you run, much like the Nike+ GPS app but without the necessity for an iPhone 4 bouncing around your person. Did we mention it's also a watch?

[Thanks, John S.]

Nike+ SportWatch GPS now on sale, $199 adds geek cred to your workout routine originally appeared on Engadget on Sat, 02 Apr 2011 17:37:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>debutGPSNikeNike+Nike+ GPSNike+ SportWatch GPSNike+GpsNike+SportwatchGpson saleOnSalesportsSportWatch GPSSportwatchGpsTomTomwatchwristwatchSat, 02 Apr 2011 17:37:00 EST<![CDATA[Sneaker speakers kick out the jams]]>http://www.engadget.com/2011/03/02/sneaker-speakers-kick-out-the-jams/http://www.engadget.com/2011/03/02/sneaker-speakers-kick-out-the-jams/http://www.engadget.com/2011/03/02/sneaker-speakers-kick-out-the-jams/#comments
We've seen homemade speakers crafted from all sorts of unusual objects, but these new sneaker speakers built for a design competition by professional sneaker customizer Nashmoney might just be the new king in town. As you can see, they started out as a regular pair of Nike Air Force 1s, and all of the speaker components are built right into the sneakers, including the amplifier and the controls. Of course, they're also one of a kind, but you can find some pictures and details of the build process at the link below if you have an old pair of kicks you'd like to try to retrofit yourself.

Sneaker speakers kick out the jams originally appeared on Engadget on Wed, 02 Mar 2011 21:56:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>air force 1AirForce1diyhomemademodNashmoneynikenike air force 1NikeAirForce1sneaker speakerssneakersSneakerSpeakersspeakersWed, 02 Mar 2011 21:56:00 EST<![CDATA[Nike+ SportWatch GPS with TomTom hands-on]]>http://www.engadget.com/2011/01/05/nike-sportwatch-gps-with-tomtom-hands-on/http://www.engadget.com/2011/01/05/nike-sportwatch-gps-with-tomtom-hands-on/http://www.engadget.com/2011/01/05/nike-sportwatch-gps-with-tomtom-hands-on/#comments We nearly burned an actual calorie at Nike's booth here at a CES event this evening as we powered through a demo of the company's new Nike+ SportsWatch GPS. That "GPS" part is important, see, because the watch was developed in cooperation with the navigation wizards at TomTom -- in fact, a TomTom logo is prominently featured below the dot matrix LCD. Really, the SportsWatch GPS isn't much different than other high-end GPS fitness watches on the market, it's just got that typical dash of Nike style in the case, the band, and in the hipster lower-case UI. Our second feature might be the "slap" gesture -- slapping the display enables the backlight or indicates a lap while you're in the middle of a run. Our favorite feature, though, might be the PC connectivity: you flip a hinge on one end of the band to reveal a USB plug and you're good to go. As with other Nike+ products, you can store your runs in the system's online community or let the watch collect up to 50 runs offline. Follow the break for the press release and a video demo, which we cordially ask you to avoid watching unless you're on... you know, a StairMaster or something.

Gallery: Nike+ SportWatch GPS with TomTom hands-on

Continue reading Nike+ SportWatch GPS with TomTom hands-on

Nike+ SportWatch GPS with TomTom hands-on originally appeared on Engadget on Wed, 05 Jan 2011 23:07:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>cesces 2011ces2011hands-onnikenike plusnike plus sportwatch gpsNikePlusNikePlusSportwatchGpstomtomvideowatchwristwatchWed, 05 Jan 2011 23:07:00 EST<![CDATA[Inhabitat's Week in Green: pencil-tip generators, the Nissan Leaf, and the world's largest wind turbine]]>http://www.engadget.com/2010/12/06/inhabitats-week-in-green-pencil-tip-generators-the-nissan-lea/http://www.engadget.com/2010/12/06/inhabitats-week-in-green-pencil-tip-generators-the-nissan-lea/http://www.engadget.com/2010/12/06/inhabitats-week-in-green-pencil-tip-generators-the-nissan-lea/#commentsEach week our friends at Inhabitat recap the week's most interesting green developments and clean tech news for us -- it's the Week in Green.

This week we saw renewable energy take the world by storm as Spain announced plans to construct the world's largest wind turbine and a team of engineers made waves with plans for an underwater turbine modeled after whale flippers. We also saw Boeing shine light on plans to produce a new breed of ultra-efficient solar panels that are suited for space, while researchers in Japan developed a potent new kinetic generator that's as tiny as a pencil tip.

Innovative eco transportation also picked up the pace as China rolled out plans to produce the first fuel cell powered light rail train and the world's largest solar-powered boat made its successful maiden voyage across the Atlantic. We also applauded the Nissan Leaf as it took first place as the European Car of the Year and we were wowed by Mercedes' next-generation concept car, which may one day be grown in a lab.

We also showcased several new ways that technology stands to wire our lives -- starting with an electronic smart wallet that curbs spending by clamping shut like a clam. We also looked at Harvard's plans for a laptop computer powered by biogas and we were impressed by Nike's next-gen design tools for producing environmentally efficient clothes. Finally, we wrapped up the week with two exciting advances in tablet tech - India is testing a solar-powered I-Slate tablet geared at children in need and Substrata rolled out a gorgeous wooden iPad case that goes light on the earth.

Inhabitat's Week in Green: pencil-tip generators, the Nissan Leaf, and the world's largest wind turbine originally appeared on Engadget on Mon, 06 Dec 2010 02:46:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>car of the yearCarOfTheYearclothclothingdesignenergy harvestingEnergyHarvestinggeneratorHarvardI-SlateIndiainhabitatinhabitat.cominhabitats week in greenInhabitatsWeekInGreenkinetic energykinetic generatorKineticEnergyKineticGeneratorleafnikenissan leafNissanLeafsmart walletSmartWalletsolarsolar powerSolarPowerturbinewalletwindwind powerWindPowerMon, 06 Dec 2010 02:46:00 EST<![CDATA[App review: Nike+ GPS]]>http://www.engadget.com/2010/09/07/app-review-nike-gps/http://www.engadget.com/2010/09/07/app-review-nike-gps/http://www.engadget.com/2010/09/07/app-review-nike-gps/#comments Nike's dalliances with technology should be familiar to our readers by now, with the crowning jewel of course being the Nike+ run-tracking software that pairs a shoe-mounted sensor with your iPhone or iPod. Well, it was. The gargantuan sportswear company is moving with the times and throwing the hardware away with the introduction of its all-new Nike+ GPS application. No longer restricting our running shoe choice is groovy, but the app itself has the even loftier aim of simultaneously acting as your fitness guru, motivator and record keeper. And all it asks in return is access to the accelerometer and GPS modules inside your iOS 4-equipped iPhone or iPod touch (the latter's lack of GPS means it loses out on route mapping, but all other features are retained). So, let's see how this baby runs, shall we?

Gallery: Nike+ GPS app screenshots


Continue reading App review: Nike+ GPS

App review: Nike+ GPS originally appeared on Engadget on Tue, 07 Sep 2010 15:26:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>appapp reviewappleapplicationAppReviewattaboysexercisefitnessgpsiosios appIosAppiphoneiphone appIphoneAppjogjoggingnikenike appnike plusnike plus gpsnike+nike+ appnike+ gpsnike+ iphoneNike+AppNike+GpsNike+IphoneNikeAppNikePlusNikePlusGpspedometerreviewrunrunningworkoutTue, 07 Sep 2010 15:26:00 EST<![CDATA[Nike Air Maxes get a Wii Balance Board infusion]]>http://www.engadget.com/2010/08/27/nike-air-maxes-get-a-wii-balance-board-infusion/http://www.engadget.com/2010/08/27/nike-air-maxes-get-a-wii-balance-board-infusion/http://www.engadget.com/2010/08/27/nike-air-maxes-get-a-wii-balance-board-infusion/#comments Recently Nike -- a shoe company that seems to enjoy a side dish of tech from time to time -- challenged 78 artists to "hack" its shoes and come up with something decidedly different than your typical Air Force Ones. Now, a lot of the projects were more art and less tech, but that can't be said for entrant Nick Marsh's contribution to the experiment. The designer fused the internals of a Wii Balance Board with a pair of Air Maxes to create a gaming experience that may not be nuanced, but certainly seems capable of making you break a sweat. According to Nick, games are played exactly as they would have been previously, but since you can't step of the board, you're required to lift your foot or sit down when you need to back off on the pressure. Nick finished the project in April, but it sounds like a slightly more polished version could be in the offing. Check out a quick video of the shoes in action after the break, and hit the source for a slew of pics.

Continue reading Nike Air Maxes get a Wii Balance Board infusion

Nike Air Maxes get a Wii Balance Board infusion originally appeared on Engadget on Fri, 27 Aug 2010 11:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>air maxAirMaxartart projectArtProjectbasketball shoesBasketballShoesculturediyhacknikenike 78nike air maxNike78NikeAirMaxnintendorunning shoesRunningShoesshoeshoestweakvideowiiwii balance boardWiiBalanceBoardFri, 27 Aug 2010 11:45:00 EST<![CDATA[Nike files patent for auto-lacing sneakers, Marty McFly doth protest]]>http://www.engadget.com/2010/08/26/nike-files-patent-for-auto-lacing-sneakers-marty-mcfly-doth-pro/http://www.engadget.com/2010/08/26/nike-files-patent-for-auto-lacing-sneakers-marty-mcfly-doth-pro/http://www.engadget.com/2010/08/26/nike-files-patent-for-auto-lacing-sneakers-marty-mcfly-doth-pro/#comments We've seen some extremely DIY auto-lacing sneakers, but it looks like the big boys -- Nike -- have thought about getting in on the game as well. Patent filings which occurred in early through late 2009 show off an automatic lacing system that is pretty reminiscent of Marty McFly's invention in Back to the Future, and we can tell you that from the looks of it, it's a future we'd definitely like to inhabit. The shoes appear to boast a charging system and lights in addition to the lacing component, and while so few patent apps ever lead to a real retail product, we're really rooting for this one. One more image below.

Continue reading Nike files patent for auto-lacing sneakers, Marty McFly doth protest

Nike files patent for auto-lacing sneakers, Marty McFly doth protest originally appeared on Engadget on Thu, 26 Aug 2010 00:59:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>autolacingnikepatentpatent applicationPatentApplicationpatentsshoessneakerstennish shoesTennishShoeswearablesThu, 26 Aug 2010 00:59:00 EST<![CDATA[Polar and Nike announce WearLink+ heart rate monitor for Nike+]]>http://www.engadget.com/2010/06/08/polar-and-nike-announce-wearlink-heart-rate-monitor-for-nike/http://www.engadget.com/2010/06/08/polar-and-nike-announce-wearlink-heart-rate-monitor-for-nike/http://www.engadget.com/2010/06/08/polar-and-nike-announce-wearlink-heart-rate-monitor-for-nike/#comments Well, it's not June 1st, but Nike+ users now finally have a heart rate monitor to help kick their training up a notch in the form of the just-announced Polar WearLink+. That is naturally compatible with all Nike+ gear, and it will let you see your BPM at a glance on your Nike+ SportBand, or hear spoken feedback of your BPM while you run on your iPod nano. The heart rate monitor will even work with Polar's own range of training computers and Polar-compatible fitness equipment at the same time, and it has a soft textile chest strap that promises to "seamlessly adapt" to your body shape (it's also thankfully machine-washable). Look for the strap to be available in the US this month for $69.95, with a release in Canada and Europe set to follow in July. Full press release is after the break.

Continue reading Polar and Nike announce WearLink+ heart rate monitor for Nike+

Polar and Nike announce WearLink+ heart rate monitor for Nike+ originally appeared on Engadget on Tue, 08 Jun 2010 02:04:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>excercisefitnessheart rate monitorHeartRateMonitoripod nanoIpodNanonikenike+polarrunningtrainingwearlinkwearlink+Tue, 08 Jun 2010 02:04:00 EST<![CDATA[Nike+ heart rate monitor tipped for June 1 launch]]>http://www.engadget.com/2010/05/19/nike-heart-rate-monitor-tipped-for-june-1-launch/http://www.engadget.com/2010/05/19/nike-heart-rate-monitor-tipped-for-june-1-launch/http://www.engadget.com/2010/05/19/nike-heart-rate-monitor-tipped-for-june-1-launch/#commentsIt was hinted at back in September 2009, now it appears certain that Nike will deliver a Nike+ heart rate monitor iPod accessory to the US on June 1st. The following Nike forum post by a long-time contributor and a suspected Nike employee has set heart valves aflutter:
"I have a U.S. launch date for the Nike+ compatible heart rate monitor. It will officially launch on June 1, 2010, although it may reach some retail outlets slightly sooner. It will reach Canadian markets in June and will launch internationally in summer 2010, exact date to be determined."
We might buy one just to prove that we're still alive.

Nike+ heart rate monitor tipped for June 1 launch originally appeared on Engadget on Wed, 19 May 2010 02:10:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>appleheartheart monitorheart rate monitorHeartMonitorHeartRateMonitoripodnikenike plusnike+NikePlusplusrumorWed, 19 May 2010 02:10:00 EST<![CDATA[Crazed turntablists transform sneakers into sound controllers, righteous beats result (video)]]>http://www.engadget.com/2010/04/16/crazed-turntablists-transform-sneakers-into-sound-controllers-r/http://www.engadget.com/2010/04/16/crazed-turntablists-transform-sneakers-into-sound-controllers-r/http://www.engadget.com/2010/04/16/crazed-turntablists-transform-sneakers-into-sound-controllers-r/#comments
We're generally quite wary of any video meant to "go viral" and "sell a lot of shoes" (or sell a lot of whatever), but from time to time something comes along and cracks our jaded shell. Case in point: the new Japanese campaign for Nike's Free Run+ running shoes sees experimental musician / DJ Daito Manabe and co. bangin' out a tune with the company's newest. The kicks are outfitted with flex sensors (which change resistance when bent), allowing some impressive control of effects via Max/MSP and Ableton Max for Live. Have you ever wanted to hear a hip-hop version of Thus Spoke Zarathustra? How about one performed on running shoes? You're in luck -- we got it for you after the break.

Continue reading Crazed turntablists transform sneakers into sound controllers, righteous beats result (video)

Crazed turntablists transform sneakers into sound controllers, righteous beats result (video) originally appeared on Engadget on Fri, 16 Apr 2010 15:18:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>abletonableton liveAbletonLivecontrollerfree run+freen run+FreenRun+FreeRun+maxmspmusic makingMusicMakingnikenike free run +NikeFreeRun+sound controllerSoundControllervideoFri, 16 Apr 2010 15:18:00 EST<![CDATA[Artist crafts Pentium Nikes but Mom buys us AMD Keds anyways]]>http://www.engadget.com/2009/11/12/artist-crafts-pentium-nikes-but-mom-buys-us-amd-keds-anyways/http://www.engadget.com/2009/11/12/artist-crafts-pentium-nikes-but-mom-buys-us-amd-keds-anyways/http://www.engadget.com/2009/11/12/artist-crafts-pentium-nikes-but-mom-buys-us-amd-keds-anyways/#comments
If there are two things we love here at Engadget, it's our PCs and our kicks -- that's why we were tickled when trash artist and bon vivant Gabriel Dishaw decided to memorialize the Nike Blazer with a sculpture rendered from an old circuit board. Titled "Nike Blazer Pentium 1.0," this is the first part of a series of classic sneakers -- and we must say, this one looks pretty good, if somewhat uncomfortable. Hit the read link to inquire about purchasing some art for yourself, but not before getting a closer look or two after the break.

[Thanks, daklar]

Continue reading Artist crafts Pentium Nikes but Mom buys us AMD Keds anyways

Artist crafts Pentium Nikes but Mom buys us AMD Keds anyways originally appeared on Engadget on Thu, 12 Nov 2009 18:19:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>artblazerGabriel DishawGabrielDishawgarbagekicksnikenike blazerNike Blazer Pentium 1.0NikeBlazerNikeBlazerPentium1.0pentiumscultpuresneakerstrashtrash arttrashartThu, 12 Nov 2009 18:19:00 EST<![CDATA[Apple adds video camera, larger screen to new 5G iPod nano]]>http://www.engadget.com/2009/09/09/apple-slaps-video-camera-into-new-ipod-nano/http://www.engadget.com/2009/09/09/apple-slaps-video-camera-into-new-ipod-nano/http://www.engadget.com/2009/09/09/apple-slaps-video-camera-into-new-ipod-nano/#comments
Apple sure took long enough to get to this, but just as rumored, the iPod nano is seeing a hotly-anticipated refresh today. The big addition? A camera that just so happens to shoot live video (but not stills, apparently). On the lower left of the new fifth-generation nano, you'll find the camera as well as a speaker and microphone, but unfortunately you'll have to sync it with your computer before you upload clips to YouTube. The camera-laden nanos will be available starting today in a rainbow's worth of hues (nine, if we're being precise), with the 8GB model pegged at $149 and the 16GB edition at $179 -- though, we should mention that yellow and red are Apple Store exclusives. Oh, and oddly / tragically enough, the iPod nano is officially the only dedicated iPod with a camera, leaving the iPod touch -- and every human on the planet -- scratching their head in befuddlement. Meanwhile, iPhone 3G users are equally bewildered by the fact that a mid-range iPod can shoot video while a fully-capable smartphone cannot.

As for other specs, you'll find a built-in FM tuner with Live Pause (!) and iTunes Tagging, a pedometer (you know, for that fancy Nike+ integration), VoiceOver, support for voice memos and a larger 2.2-inch display (up from 2.0-inches) with a 376 x 240 resolution. As for the camera, we're told that the video capture mode snags footage in VGA quality (640 x 480) H.264, with up to 30fps and AAC audio. If you're feeling fancy, there's also 15 real-time special effects including Sepia, Black and White, X-Ray, Film Grain, Thermal, Security Cam, Cyborg, Bulge, Kaleido and Motion Blur (among others). As for dimensions, the 5G nano remains identical to the 4G nano at 3.6- x 1.5- x 0.24-inches, though it somehow shaves a whopping 0.02 ounces as it climbs down from 1.3 to 1.28 ounces. Curious about battery life? Apple claims that the new nano can last up to 24 hours when playing back audio (same as 4G nano), while video playback should zap the rechargeable battery in just five hours (which is up an hour over its predecessor).

Update: Check out our first hands-on live from the event!

Gallery: 5G Apple iPod nano with video camera press shots


Gallery: iPod nano gets a video camera, larger display, FM tuner, more

Apple adds video camera, larger screen to new 5G iPod nano originally appeared on Engadget on Wed, 09 Sep 2009 12:51:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>Applebreaking newsBreakingNewscamcordercameraflip videoFlipVideoipod nanoIpodNanoitunesitunes taggingItunesTaggingnanonikenike plusNikePlusonly rock and rollOnlyRockAndRollpedometerpocket camcorderPocketCamcordervideo cameraVideoCameravoiceoverWed, 09 Sep 2009 12:51:00 EST<![CDATA[Nike announces updated Nike+ SportBand]]>http://www.engadget.com/2009/07/14/nike-announces-updated-nike-sportband/http://www.engadget.com/2009/07/14/nike-announces-updated-nike-sportband/http://www.engadget.com/2009/07/14/nike-announces-updated-nike-sportband/#comments
The original Nike+ SportBand was pretty well received when it rolled out last year, but time marches on, and Nike's now back for another go 'round with a slightly updated model, plus a few other bonuses for the runners and walkers out there. In addition to some new two-tone color schemes, the updated Nike+ SportBand packs an improved screen with a white background for better visibility, along with a welded seal for water resistance and, of course, all the usual Nike+ features that can be used in conjunction with iPod nano, iPod touch, or iPhone (though you can also just use the device on its own). According to Boing Boing Gadgets' just-published review of the device (linked below), all of that is "pretty rad" and, at just $59, is certainly affordable, especially considering that it can also double as a watch. What's more, Nike's also announced that it has merged its existing nikeplus.com and nikerunning.com sites into one site, and it's dropped word that an iPhone / iPod touch-specific website is also in the works, although there's no word on a launch date for it just yet.

Read - Nike+ SportBand Press Release
Read - Boing Boing Gadgets Review

[Via ipodnn]

Filed under:

Nike announces updated Nike+ SportBand originally appeared on Engadget on Tue, 14 Jul 2009 04:16:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>athleticsnike nike sportbandNike SportbandrunningsportbandsportswalkingwatchTue, 14 Jul 2009 04:16:00 EST<![CDATA[Nike+iPod gets repurposed as wireless key fob]]>http://www.engadget.com/2009/05/27/nike-ipod-gets-repurposed-as-wireless-key-fob/http://www.engadget.com/2009/05/27/nike-ipod-gets-repurposed-as-wireless-key-fob/http://www.engadget.com/2009/05/27/nike-ipod-gets-repurposed-as-wireless-key-fob/#comments
Got a Nike+iPod kit laying around but not doing much exercising with it? Then you might want to follow the lead of SparkFun's Nate, who took the device and turned it into a decidedly non-exercise minded wireless key fob -- or iFob, as Nate has dubbed it. That, as you might expect, isn't exactly a completely straightforward process, and also involves putting an Arduino Pro Mini into the mix, not to mention a bit of minor surgery to both your car and your car's original key fob. If that doesn't scare you off, however, you can find the complete instructions and plenty of helpful pics at the link below, although you're on your own if you want to build something that actually starts your car.

[Via GadgetReview]

Filed under: ,

Nike+iPod gets repurposed as wireless key fob originally appeared on Engadget on Wed, 27 May 2009 16:24:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>diyfobhackhacksifobkey fobKeyFobmodmodsnikenike ipodwireless key fobWirelessKeyFobWed, 27 May 2009 16:24:00 EST<![CDATA[Apple has so much more where Nike+ came from]]>http://www.engadget.com/2008/09/11/apple-has-so-much-more-where-nike-came-from/http://www.engadget.com/2008/09/11/apple-has-so-much-more-where-nike-came-from/http://www.engadget.com/2008/09/11/apple-has-so-much-more-where-nike-came-from/#comments
Apple has a batch diagrams and patent-speak that it just shuffled past the patent office, detailing a next-generation Nike+ system that will make runners jump for joy, and non-athletes groan in agony. We're not sure if this is going to be something that Nike can just build shoes for and use existing Apple hardware, or if this'll be a reworking of the whole kit, but there's a lot of new stuff going on here. The system relies on integrating GPS and additional shoe-based sensors into the system, put to work in measuring your stride, the condition of the shoe, and perhaps even blasting you advertisements along your run route. The system can measure your velocity with accuracy in the range of 0.1 MPH, and let you know if you're a toe-planter or a heel-planter when you run. It just can't lug your lazy ass out of bed.

Filed under:

Apple has so much more where Nike+ came from originally appeared on Engadget on Thu, 11 Sep 2008 09:40:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>applenike runningThu, 11 Sep 2008 09:40:00 EST<![CDATA[Debunk: the iPod touch Bluetooth chip is really the Nike+ receiver]]>http://www.engadget.com/2008/09/10/debunk-the-ipod-touch-bluetooth-chip-is-really-the-nike-receiv/http://www.engadget.com/2008/09/10/debunk-the-ipod-touch-bluetooth-chip-is-really-the-nike-receiv/http://www.engadget.com/2008/09/10/debunk-the-ipod-touch-bluetooth-chip-is-really-the-nike-receiv/#comments
Usually product teardowns are only interesting for the raw, visceral thrill of seeing chipsets and circuit boards splayed wide open, but iFixit's disassembly of the new iPod touch revealed something rather more interesting: a Broadcom BCM4325 Bluetooth 2.1+EDR chip. (That's the silver rectangle in the middle of the top circuit board there.) That's got a lot of people all atwitter, but there's an obvious explanation for it: Nike+, built into the new touch, is based on a proprietary low-power 2.4GHz communications protocol called ANT -- not quite the standard Bluetooth frequency, but awful close. Yep, sorry, it's for technojogging, not secret A2DP -- although we'd welcome actual Bluetooth support in the touch with open arms. Hit the read link for the complete breakdown.

Update: Just to be totally accurate, the BCM4325 also does WiFi -- and Nike+iPod has been called a "proprietary 802.11 protocol" in the past, so it's even less likely that it's there for actual Bluetooth usage.

Filed under: ,

Debunk: the iPod touch Bluetooth chip is really the Nike+ receiver originally appeared on Engadget on Wed, 10 Sep 2008 22:01:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>applebluetoothifixitipodipod touchIpodTouchnikenike ipodportable audioportable videoportableaudioportablevideoteardownWed, 10 Sep 2008 22:01:00 EST<![CDATA[Purported iPhone Nike+ screenshots found to be fake]]>http://www.engadget.com/2008/08/21/purported-iphone-nike-screenshots-found-to-be-fake/http://www.engadget.com/2008/08/21/purported-iphone-nike-screenshots-found-to-be-fake/http://www.engadget.com/2008/08/21/purported-iphone-nike-screenshots-found-to-be-fake/#commentsAnd to think, we actually believed that Nike and Apple were this close to delivering the long-awaited running application for the iPhone. While it was widely reported that these shots were indeed the real deal, AppleInsider is pointing out a chink in the armor: Cupertino doesn't offer iPhone developers a programming interface for accessing one's music, yet this mysterious program clearly showed someone listening to Chris Martin and friends (an unreleased song, evidently) while attempting to make it to 0.02km. The take away? It's still pretty likely that the two outfits are working to create a fitness program for the App Store, but those screenshots ain't it.

[Thanks, Michael]

Filed under: , , ,

Purported iPhone Nike+ screenshots found to be fake originally appeared on Engadget on Thu, 21 Aug 2008 07:57:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>3g iphone3gIphoneappappleapplicationexercisefakefitnessiphoneiphone 3giphone osIphone3giphoneosmobilenikenike plusNikePlusrunrunningThu, 21 Aug 2008 07:57:00 EST<![CDATA[Purported iPhone Nike+ screenshots found to be fake]]>http://www.engadget.com/2008/08/21/purported-iphone-nike-screenshots-found-to-be-fake/http://www.engadget.com/2008/08/21/purported-iphone-nike-screenshots-found-to-be-fake/http://www.engadget.com/2008/08/21/purported-iphone-nike-screenshots-found-to-be-fake/#commentsAnd to think, we actually believed that Nike and Apple were this close to delivering the long-awaited running application for the iPhone. While it was widely reported that these shots were indeed the real deal, AppleInsider is pointing out a chink in the armor: Cupertino doesn't offer iPhone developers a programming interface for accessing one's music, yet this mysterious program clearly showed someone listening to Chris Martin and friends (an unreleased song, evidently) while attempting to make it to 0.02km. The take away? It's still pretty likely that the two outfits are working to create a fitness program for the App Store, but those screenshots ain't it.

[Thanks, Michael]

Filed under:

Purported iPhone Nike+ screenshots found to be fake originally appeared on Engadget on Thu, 21 Aug 2008 07:57:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>3g iphone3gIphoneappapplicationexercisefakefitnessiphoneiphone 3gIphone3gnikenike plusNikePlusrunrunningThu, 21 Aug 2008 07:57:00 EST<![CDATA[Screenshots of iPhone Nike+ running app emerge, we're out of breath already]]>http://www.engadget.com/2008/08/19/screenshots-of-iphone-nike-running-app-emerge-were-out-of-bre/http://www.engadget.com/2008/08/19/screenshots-of-iphone-nike-running-app-emerge-were-out-of-bre/http://www.engadget.com/2008/08/19/screenshots-of-iphone-nike-running-app-emerge-were-out-of-bre/#comments
It has taken its sweet, sweet time in arriving, but it seems the iPhone Nike+ running application is just... about... here. A slew of new screenshots of the application have emerged, and while there are no juicy tidbits to accompany 'em (release date, cost, etc.), we all know how many lines of text a single snapshot is worth. Hang tight runners, the app you've been waiting (and waiting) for can't be far from the finish line now.

[Via MacRumors]

Filed under: , ,

Screenshots of iPhone Nike+ running app emerge, we're out of breath already originally appeared on Engadget on Tue, 19 Aug 2008 19:26:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>appapp storeappleapplicationAppStoreexercisefitnessiphoneiphone osiphone3giphoneosipodmobilenikenike plusNikePlusrunrunningsoftwareTue, 19 Aug 2008 19:26:00 EST<![CDATA[Screenshots of iPhone Nike+ running app emerge, we're out of breath already]]>http://www.engadget.com/2008/08/19/screenshots-of-iphone-nike-running-app-emerge-were-out-of-bre/http://www.engadget.com/2008/08/19/screenshots-of-iphone-nike-running-app-emerge-were-out-of-bre/http://www.engadget.com/2008/08/19/screenshots-of-iphone-nike-running-app-emerge-were-out-of-bre/#comments
It has taken its sweet, sweet time in arriving, but it seems the iPhone Nike+ running application is just... about... here. A slew of new screenshots of the application have emerged, and while there are no juicy tidbits to accompany 'em (release date, cost, etc.), we all know how many lines of text a single snapshot is worth. Hang tight runners, the app you've been waiting (and waiting) for can't be far from the finish line now.

[Via MacRumors]

Filed under: ,

Screenshots of iPhone Nike+ running app emerge, we're out of breath already originally appeared on Engadget on Tue, 19 Aug 2008 19:26:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>appapp storeapplicationAppStoreexercisefitnessiphoneiphone3gipodnikenike plusNikePlusrunrunningsoftwareTue, 19 Aug 2008 19:26:00 EST<![CDATA[Hello? McFly 2015 Nikes to be resurrected as Nike Hyperdunks]]>http://www.engadget.com/2008/06/29/hello-mcfly-2015-nikes-to-be-resurrected-as-nike-hyperdunks/http://www.engadget.com/2008/06/29/hello-mcfly-2015-nikes-to-be-resurrected-as-nike-hyperdunks/http://www.engadget.com/2008/06/29/hello-mcfly-2015-nikes-to-be-resurrected-as-nike-hyperdunks/#commentsMcFly 2015 Hyperdunk
Remember those cool Nike high-tops that Marty McFly wore in Back to the Future? The ones that laced themselves and you wished you had a pair just like them? If so, listen up: Nike is releasing the Marty McFly 2015's as the Nike Hyperdunks. They won't lace themselves, unfortunately, but will be made of Nike's super light-weight materials. They'll be shilled by Kobe Bryant in black, and we'll be surprised if the Back to the Future roots of these shoes will be shown the light in order to keep the cool young'ns interested, but we all know the truth behind these bitchin' kicks. Hoverboard sold separately.

Filed under:

Hello? McFly 2015 Nikes to be resurrected as Nike Hyperdunks originally appeared on Engadget on Sun, 29 Jun 2008 10:03:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>hyperdunkkobe bryantKobeBryantmcfly 2015Mcfly2015nikenike hyperdunkNikeHyperdunkshoesSun, 29 Jun 2008 10:03:00 EST<![CDATA[Nike+ gym equipment coming July -- iPhone integration imminent?]]>http://www.engadget.com/2008/06/27/nike-gym-equipment-coming-july-iphone-integration-imminent/http://www.engadget.com/2008/06/27/nike-gym-equipment-coming-july-iphone-integration-imminent/http://www.engadget.com/2008/06/27/nike-gym-equipment-coming-july-iphone-integration-imminent/#comments
24 Hour Fitness just announced that it will be the first to offer Nike+ iPod enabled gym equipment at select clubs starting next month. The press release says the following:

"Nike and Apple worked with major gym equipment manufacturers to make their cardio equipment Nike + iPod compatible so gym members can easily track and record workouts on cardio equipment like treadmills, stair steppers, elliptical trainers and stationary bikes."

The press release only mentions the iPod nano. In fact, that may be all that we're talking about here. Nevertheless, July is synonymous with the iPhone 3G, 2.0 firmware, and App Store launches and there's that little ol' patent application (the source of the picture above) which describes leveraging the iPhone's sensors to turn it into a "lifestyle companion." Nike of course, already confirmed that its Plus system would be extending to the iPhone and iPod touch sometime in the future. July seems as good a time as any don't you think?

Filed under: , ,

Nike+ gym equipment coming July -- iPhone integration imminent? originally appeared on Engadget on Fri, 27 Jun 2008 07:27:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>24 hour fitness24HourFitnessgymiphoneipodnikenike plusNikePlusportable audioportable videoportableaudioportablevideospeculationFri, 27 Jun 2008 07:27:00 EST<![CDATA[Nike PhotoiD lets you create hideous shoes from the comfort of your cameraphone]]>http://www.engadget.com/2008/06/18/nike-photoid-lets-you-create-hideous-shoes-from-the-comfort-of-y/http://www.engadget.com/2008/06/18/nike-photoid-lets-you-create-hideous-shoes-from-the-comfort-of-y/http://www.engadget.com/2008/06/18/nike-photoid-lets-you-create-hideous-shoes-from-the-comfort-of-y/#comments
If you get a pair of blindingly bright clown shoes in the mail a few days after a late night of drunken revelry that you don't particularly recall... well, we think we know what happened. A new service from Nike in some European countries called "PhotoiD" allows cameraphone owners to snap a picture of pretty much anything their little hearts desire, send it to a short code via MMS, and get a rendered shoe in reply that uses the picture's two most dominant colors as its highlights. If you're feeling the kicks -- 1985 Dunk hightops, if you must know -- you can even buy them, which we figure is where things really start to get interesting. Creative on Nike's part, yes, but also a danger to the good sense of shoe-wearing shutterbugs everywhere.

[Via guardian.co.uk]

Filed under: ,

Nike PhotoiD lets you create hideous shoes from the comfort of your cameraphone originally appeared on Engadget on Wed, 18 Jun 2008 08:29:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>messagingmmsmobilenikephotoidshoeshoesWed, 18 Jun 2008 08:29:00 EST<![CDATA[Custom Illuminated Confusion Nikes light up the streets, your life]]>http://www.engadget.com/2008/05/17/custom-illuminated-confusion-nikes-light-up-the-streets-your-li/http://www.engadget.com/2008/05/17/custom-illuminated-confusion-nikes-light-up-the-streets-your-li/http://www.engadget.com/2008/05/17/custom-illuminated-confusion-nikes-light-up-the-streets-your-li/#comments
Personally, we'd prefer slipping our feet into the WiFi-detecting Nike Dunks if given a choice, but it's hard to argue with the smooth factor bundled with the highly customized kicks shown above. Dubbed Illuminated Confusion, the shoes feature a pattern print with "neon green light-up lateral sides that either blink or glow." The lighting on each shoe gets powered by a single AAA cell, and you'll even get a free "custom box" with you order. And considering the $400 price tag and two to three week wait time, we wouldn't expect anything less. Vid after the jump.

Continue reading Custom Illuminated Confusion Nikes light up the streets, your life

Filed under:

Custom Illuminated Confusion Nikes light up the streets, your life originally appeared on Engadget on Sat, 17 May 2008 14:03:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>customdiyfootwearilluminated confusionIlluminatedConfusionlightlight-upneonnikenike dunkNikeDunkshoeshoesvideoSat, 17 May 2008 14:03:00 EST<![CDATA[Nike Dunks + WiFi = A Step in the Right Direction]]>http://www.engadget.com/2008/05/04/nike-dunks-wifi-a-step-in-the-right-direction/http://www.engadget.com/2008/05/04/nike-dunks-wifi-a-step-in-the-right-direction/http://www.engadget.com/2008/05/04/nike-dunks-wifi-a-step-in-the-right-direction/#comments
Get ready to pay atelier sneaker prices for these babies, because designer MSTRPLN (not to be confused with MSTRKRFT) and Ubiq (not to be confused with Ubiquio) teamed up to produce some straight black Nike Dunks with built-in WiFi detection. It's called A Step in the Right Direction, and we might actually agree.

[Thanks, JideOsan]

Filed under: ,

Nike Dunks + WiFi = A Step in the Right Direction originally appeared on Engadget on Sun, 04 May 2008 05:36:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>A Step in the Right DirectionAStepInTheRightDirectiondunksmstrplnnikesneakersubiqSun, 04 May 2008 05:36:00 EST<![CDATA[Nike+ SportBand gets reviewed]]>http://www.engadget.com/2008/04/16/nike-sportband-gets-reviewed/http://www.engadget.com/2008/04/16/nike-sportband-gets-reviewed/http://www.engadget.com/2008/04/16/nike-sportband-gets-reviewed/#comments
For those breaking into a sweat trying to decide whether or not the Nike+ SportBand is really worth your hard earned dollars / euros / pounds / Schrutebucks, simmer on down. The runners over at the Stuff offices have snapped one up and tossed out their two pence. Summarized as a "Nike+iPod system without music," the unit was given fairly high marks all around. It was noted that calibration was highly recommended before taking on the London Marathon, but that setup was a real lesson in simplicity. Design wise, most everything was kosher save for the detachable face (Link USB drive) that may not fit perfectly in slim laptops sitting flush on a table and the non-backlit display that proved difficult to see at night. Believe it or not, critics still found the SportBand to be a joy to use despite the aforesaid quirks, but given the drawbacks, we'd certainly recommend trying out a pal's before throwing down for your own.

Filed under:

Nike+ SportBand gets reviewed originally appeared on Engadget on Wed, 16 Apr 2008 11:09:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>exercisefitnessnikereviewreviewedsportbandWed, 16 Apr 2008 11:09:00 EST<![CDATA[Nike+ going WiFi and 3G, headed to iPhone]]>http://www.engadget.com/2008/04/11/nike-going-wifi-and-3g-headed-to-iphone/http://www.engadget.com/2008/04/11/nike-going-wifi-and-3g-headed-to-iphone/http://www.engadget.com/2008/04/11/nike-going-wifi-and-3g-headed-to-iphone/#comments
Stuff.tv is kicking back in Nike's HQ at the moment and claims to have official word about Nike's future plans with Apple. They say that the Nike+ system will "definitely" extend beyond the iPod nano to support the relatively bulky iPhone and iPod touch. Interestingly, it will leap-frog the proprietary RF link between the shoe module and nano adapter to take advantage of WiFi and eventually 3G. This of course leads to all kinds of speculation with regard to Apple's "lifestyle companion" patent we showed you last month. 3G support would presumably allow for real-time coaching and uploads of your training activity through the Nike Plus website. So let's see... cellphone (check), iPod (check), Internet device (check), handheld gaming (almost), and now a Nike lifestyle companion (could be).

Filed under: , ,

Nike+ going WiFi and 3G, headed to iPhone originally appeared on Engadget on Fri, 11 Apr 2008 05:10:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>applebreaking newsBreakingNewsiphoneipod touchIpodTouchnikenike plusNikePlusportable audioportable videoportableaudioportablevideorumorFri, 11 Apr 2008 05:10:00 EST<![CDATA[Nike+ SportBand purchased early, unboxed for all to see]]>http://www.engadget.com/2008/04/09/nike-sportband-purchased-early-unboxed-for-all-to-see/http://www.engadget.com/2008/04/09/nike-sportband-purchased-early-unboxed-for-all-to-see/http://www.engadget.com/2008/04/09/nike-sportband-purchased-early-unboxed-for-all-to-see/#comments
Nah, it's not April 10th just yet (in most of the world, at least), but one particular bloke managed to score one of Nike's new SportBands at a London marathon exhibition today. The going rate on that side of the pond was £40 ($78), but we wouldn't mind that dreadful exchange rate too much if you're curious about eventual US pricing. Nevertheless, feel free to tap the read link to peep the unit fresh out of its packaging, but be forewarned, there aren't any surprises.

[Thanks, Terry]

Filed under:

Nike+ SportBand purchased early, unboxed for all to see originally appeared on Engadget on Wed, 09 Apr 2008 15:31:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>exercisefitnessin the wildInTheWildipodnikenike coachnike ipodnike pluspicspicturesrunningsportbandunboxunboxedWed, 09 Apr 2008 15:31:00 EST