Engadget http://www.engadget.com Engadget http://www.blogsmithmedia.com/www.engadget.com/media/feedlogo.gif Engadget http://www.engadget.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Saginomiya driving simulator steers real car, isn't quite Avatar on wheels (video)]]>http://www.engadget.com/2012/05/30/saginomiya-driving-simulator-steers-real-car/http://www.engadget.com/2012/05/30/saginomiya-driving-simulator-steers-real-car/http://www.engadget.com/2012/05/30/saginomiya-driving-simulator-steers-real-car/#comments Image

Most simulators act in isolation from the real world, so when we see one that breaks out of its virtual shell, we're more than a little intrigued. Saginomiya has designed a driving simulator that's directly linked to an actual car's components sitting on a six-axis motion system. The whole affair works as a form of virtuous circle for testing, where the real parts feed on the simulator and vice versa: since the simulator is based on the internal model of the car, it can translate road results directly to the suspension and steering of the physical components, which promptly loop around and dictate force feedback in the simulator through actuators in the steering wheel. Apart from creating what amounts to the real real driving simulator, Saginomiya's invention is a huge boon to automakers, which can test how key components work without having to build the whole vehicle first. Sadly, the simulator likely won't reach full-on Avatar levels and steer a car on a real road anytime soon, but it's engaging enough that we can see more than a few test drivers putting in overtime just for kicks.

Continue reading Saginomiya driving simulator steers real car, isn't quite Avatar on wheels (video)

Saginomiya driving simulator steers real car, isn't quite Avatar on wheels (video) originally appeared on Engadget on Wed, 30 May 2012 00:17:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>cardrivingdriving simulatorDrivingSimulatorsaginomiyasimulatorsteeringsteering wheelSteeringWheelsuspensiontest drivetest drivertest drivingTestDriveTestDriverTestDrivingtransportationvehiclevideoWed, 30 May 2012 00:17:00 EST<![CDATA[Ariel Atom-inspired simulator touts world's first 180-degree spherical projector screen (video)]]>http://www.engadget.com/2012/05/05/ariel-and-motion-simulation-tl1-race-simulator/http://www.engadget.com/2012/05/05/ariel-and-motion-simulation-tl1-race-simulator/http://www.engadget.com/2012/05/05/ariel-and-motion-simulation-tl1-race-simulator/#comments Image

The Ariel Atom is arguably one of the greatest bangs for the buck in terms of sports car performance, so it's no surprise that the automaker has paired up with Motion Simulation to design a particularly special simulator for both hardcore fans as well pro racing drivers and pilots. The TL1 has the world's first 180-degree spherical projection unit (technically, three projector screens acting as one) to give you that advance view of the apex without display bezels getting in the way. Its seat not only adjusts to fit different breeds of cars and aircraft but, if you opt for it, tucks in a motion transducer that will properly jolt you when you hit a bump in the road. What may please extra-serious racing game fans the most is the off-the-shelf nature of the computer needed to drive the TL1 properly: as long as your graphics hardware can handle the extra-wide 5760 x 1200 resolution, any typical Windows XP or Windows 7 desktop will do. The real question is whether your wallet can handle it, as the £11,500 ($18,573) PC-less starting price will make it tempting to buy a real Atom instead.

Continue reading Ariel Atom-inspired simulator touts world's first 180-degree spherical projector screen (video)

Ariel Atom-inspired simulator touts world's first 180-degree spherical projector screen (video) originally appeared on Engadget on Sat, 05 May 2012 23:58:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>arielariel atomArielAtomatomcarcarsdriveDrivingflightflight simulatorFlightSimulatorhdpostcrossmotion simulationmotion simulation tl1MotionSimulationMotionSimulationTl1pcraceRacingsimulatortl1windows 7windows xpWindows7WindowsXpSat, 05 May 2012 23:58:00 EST<![CDATA[Fanatec's Clubsport pedals V2 bring improved brake and clutch feel to the virtual speedway (video)]]>http://www.engadget.com/2012/04/27/fanatec-clubsport-pedals-v2-racing-sim/http://www.engadget.com/2012/04/27/fanatec-clubsport-pedals-v2-racing-sim/http://www.engadget.com/2012/04/27/fanatec-clubsport-pedals-v2-racing-sim/#comments Fanatec's Clubsport pedals V2 bring improved brake and clutch feel to the virtual speedway (video)

Around these parts, we're generally suckers for all things related to racing simulators. As such, we're excited to learn that Fanatec has unveiled its next generation of the Clubsport pedals that we reviewed over a year ago. Dubbed as the Clubsport pedals V2, the company refers to the peripheral as an "evolutionary" update to original, offering a trio of improvements. The clutch has been retooled to have a "regressive feel" that's said to be similar to a real automobile, while the brake is now of the hydraulic variety, featuring user replaceable synthetic oil -- naturally, it still has an adjustable spring and load cell pressure sensor for the utmost customizability. The final touch is merely some visual spice in the way of black anodization. Notably, there won't be any tuning kit available initially, and V1 owners might be disappointed to know that the company has opted not to offer an upgrade kit, citing costs and potentially complicated installation. Fanatec is aiming to have the Clubsport pedals V2 out by June, bundled alongside its Clubsport wheel, with pricing set at $250 for the US (€250 in the UK). Pre-orders won't begin until May, so in the meantime, shift over to the source link below and the video past the break for all the details.

Gallery: Fanatec Clubsport pedals V2

Continue reading Fanatec's Clubsport pedals V2 bring improved brake and clutch feel to the virtual speedway (video)

Fanatec's Clubsport pedals V2 bring improved brake and clutch feel to the virtual speedway (video) originally appeared on Engadget on Fri, 27 Apr 2012 14:26:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>911clubsportclubsport pedals v2ClubsportPedalsV2clutchendorfanatechydraulicload cellLoadCellpedalsporsche 911Porsche911racingracing simracing simulatorRacingSimRacingSimulatorsimulatorsteering wheelSteeringWheelv2videovideogameswheelFri, 27 Apr 2012 14:26:00 EST<![CDATA[Retired Boeing 737 repurposed as garage-kept flight simulator (video)]]>http://www.engadget.com/2012/04/18/retired-boeing-737-flight-simulator-video/http://www.engadget.com/2012/04/18/retired-boeing-737-flight-simulator-video/http://www.engadget.com/2012/04/18/retired-boeing-737-flight-simulator-video/#comments Image

A fresh concept it's not, but a fresh look? Yeah, we'll take that. California resident, air traffic controller, pilot and all-around gentleman James Price has converted the actual nose of a 1969 Boeing 737 into his own personal flight simulator. According to the man himself, he "gutted" the bird, installed "all new" parts, slid it into his garage and... well, took a few minutes to show it to the world. While pretty much any flight sim owner would claim that his or hers was "just like the real thing," it's hard to deny that fact with this one. We're told that it took some three years to complete, and the end result leaves no doubt of James' toiling. Head on past the break for the vid.

Continue reading Retired Boeing 737 repurposed as garage-kept flight simulator (video)

Retired Boeing 737 repurposed as garage-kept flight simulator (video) originally appeared on Engadget on Wed, 18 Apr 2012 22:44:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>737boeingboeing 737Boeing737californiaflightflight simflight simulatorFlightSimFlightSimulatorgaragesimulationsimulatorvideoWed, 18 Apr 2012 22:44:00 EST<![CDATA[Cybram 001 simulator helps doctors practice brain surgery without risking lives (video)]]>http://www.engadget.com/2012/04/18/cybram-001-brain-surgery-simulator/http://www.engadget.com/2012/04/18/cybram-001-brain-surgery-simulator/http://www.engadget.com/2012/04/18/cybram-001-brain-surgery-simulator/#comments Cybram 001 simulator helps doctors practice brain surgery without risking lives (video)

Sometimes it's awesome to be a guinea pig; take for example, getting down and dirty with the Consumer Preview of Windows 8. When it comes to brain surgery, however, there are no happy little accidents -- and let's face it, Bob Ross would've been a horrible surgeon. Thankfully, a new invention out of Japan promises to keep surgeons from taking practice swings at your noggin. Known as the Cybram 001, it's said to properly simulate the flow and pressure of one's arterial system from the cerebrum to the groin, and should allow doctors to gain greater familiarity with inserting surgical instruments into these delicate spaces. As the entire model is transparent, it's ideal for both students and instructors to see what's being done, and because variables such as blood pressure and heart rate can be adjusted, it's a useful simulator for different scenarios in the operating room. Not all of us will grow up to be brain surgeons, but if you'd like a peek into the frontiers of the field, just hop the break.

Continue reading Cybram 001 simulator helps doctors practice brain surgery without risking lives (video)

Cybram 001 simulator helps doctors practice brain surgery without risking lives (video) originally appeared on Engadget on Wed, 18 Apr 2012 21:32:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>brainbrain surgeryBrainSurgerycybramcybram 001Cybram001fuyojapanmedicalmedicineSaitama Medical UniversitySaitamaMedicalUniversitysimulationsimulatorsurgeryvideoWed, 18 Apr 2012 21:32:00 EST<![CDATA[Kinect makes pact with head-mounted display, virtual reality Skyrim ensues]]>http://www.engadget.com/2012/03/17/kinect-makes-pact-with-head-mounted-display-virtual-reality-sky/http://www.engadget.com/2012/03/17/kinect-makes-pact-with-head-mounted-display-virtual-reality-sky/http://www.engadget.com/2012/03/17/kinect-makes-pact-with-head-mounted-display-virtual-reality-sky/#comments Kinect and head-mounted display make love, give birth to virtual-reality SkyrimYeah, streaming Skyrim on a Tegra 3-powered Ice Cream Sandwich tablet is nice and all, but what about folks who want a more immersive experience with their beloved time sink? One tech-savvy gamer took matters into his own hands -- conjuring a bit of electronics alchemy by throwing together Sony's HMZ-T1 head-mounted display with a Kinect sensor, a TrackIR5 for head tracking and voice recognition software. The result is an experience that allows any wannabe adventurer to press onward into Tamriel's frozen north by marching in place while imbibing in a true, head-mounted first-person perspective. Admittedly, stomping around and flailing one's arms may lack the elegance and playability of The Gadget Show's $650,000 Battlefield 3 simulator, but at $1500, it's a homegrown virtual reality experience that's actually within reach. Now go forth and explore the video after the break.

Continue reading Kinect makes pact with head-mounted display, virtual reality Skyrim ensues

Kinect makes pact with head-mounted display, virtual reality Skyrim ensues originally appeared on Engadget on Sat, 17 Mar 2012 14:20:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>diygaminghackHMZ-T1kinectmicrosoft kinectsimulatorskyrimSonySony HMZ-T1SonyHmz-t1TrackIR5videovirtual gamingvirtual realityVirtualGamingVirtualRealitySat, 17 Mar 2012 14:20:00 EST<![CDATA[CircuitLab brings schematic design and sharing to the browser (video)]]>http://www.engadget.com/2012/03/04/circuitlab-brings-schematic-design-and-sharing-to-the-browser-v/http://www.engadget.com/2012/03/04/circuitlab-brings-schematic-design-and-sharing-to-the-browser-v/http://www.engadget.com/2012/03/04/circuitlab-brings-schematic-design-and-sharing-to-the-browser-v/#comments CircuitLabThe designs for all those wonderful Arduino and electronics projects don't create themselves, sadly. No, a person needs to put in time and effort laying out the circuits and carefully arranging the components, often by hand, but sometimes with aid of a software tool. A new player in that field is CircuitLab, a surprisingly full featured app for sketching out schematics and simulating them that lives entirely in the browser. It's also amazingly user friendly and simple for even the novice hobbyist to dive into. Finally, once you've finished with your project you can make the design public and share it with others. Check out the quick intro video after the break and sign up at the source.

Continue reading CircuitLab brings schematic design and sharing to the browser (video)

CircuitLab brings schematic design and sharing to the browser (video) originally appeared on Engadget on Sun, 04 Mar 2012 00:32:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>circuitcircuit designcircuit labcircuit simulatorCircuitDesignCircuitLabcircuitsCircuitSimulatorDIYdo it yourselfDoItYourselfelectronicsschematicschematicssimulatorvideoSun, 04 Mar 2012 00:32:00 EST<![CDATA[Microsoft Flight reinvents itself as free-to-play simulator (video)]]>http://www.engadget.com/2012/02/29/microsoft-flight/http://www.engadget.com/2012/02/29/microsoft-flight/http://www.engadget.com/2012/02/29/microsoft-flight/#comments
Microsoft's Flight Simulator has long prodded gamers to splash out on hardware upgrades and insane joysticks. Like Madonna, it's reinvented itself for the 21st century as a single-named free-to-play game for those who want to zoom around the skies of Hawaii. The company will make its money by selling premium add-ons including new aircraft and "adventure packs." The game is now ready for download (at the source link) and, if it proves popular, Redmond should expect a nice gift basket from AMD and NVIDIA this Christmas.

Continue reading Microsoft Flight reinvents itself as free-to-play simulator (video)

Microsoft Flight reinvents itself as free-to-play simulator (video) originally appeared on Engadget on Wed, 29 Feb 2012 08:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ControllerFlightFlight Sim ControllerFlightSimControllerFree to PlayFreeToPlayJoystickMicrosoftMicrosoft FlightMicrosoft Flight SimulatorMicrosoftFlightMicrosoftFlightSimulatorminipostOnline GameOnlineGameSimulatorvideoWindowsWindows 7Windows XPWindows7WindowsXpWed, 29 Feb 2012 08:45:00 EST<![CDATA[IED attack simulator prepares US soldiers prior to Afghan deployment]]>http://www.engadget.com/2012/01/04/ied-attack-simulator-prepares-soldiers/http://www.engadget.com/2012/01/04/ied-attack-simulator-prepares-soldiers/http://www.engadget.com/2012/01/04/ied-attack-simulator-prepares-soldiers/#comments A new simulation exercise is now in place for US troops at the Camp Atterbury Joint Maneuver Training Center near Edinburgh, Indiana. Built primarily from off-the-shelf components, the system is designed to better prepare soldiers for the physical and psychological challenges of IED attacks, which are currently the number one threat to military personnel stationed in Afghanistan. Situated inside a mounted vehicle and positioned in front of a large screen, service members are exposed to jarring explosions, smoke, noise and poor visibility -- all common occurrences of IED assaults. The system records the entire nightmarish scenario, which allows participants to review their performance and learn from their mistakes.

For soldiers who've never been to Afghanistan, the simulator will also be used to familiarize troops with the war zone terrain and other situations they may encounter along the way. Just how realistic is the IED simulation? According to Spc. Darren J. Ganier-Slotterbeck, "I deployed in 2005, 2007 and 2008 with the Marines. I've been blown up multiple times, and it definitely brought back memories. I was a little shaky when I got out of that thing. I'm not going to lie." He went on to say, "If we'd had the ability to go through training like this at the time, those deployments would have been a lot different." Sounds scary. We're not going to lie.

IED attack simulator prepares US soldiers prior to Afghan deployment originally appeared on Engadget on Wed, 04 Jan 2012 07:32:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>armed forcesArmedForcesarmyatterburybattlebattlefieldcamp atterburyCampAtterburyiedimprovised explosive deviceImprovisedExplosiveDevicemilitarymilitary techMilitaryTechsimulationsimulatortacticalus armyUsArmywarwargadgetWed, 04 Jan 2012 07:32:00 EST<![CDATA[British training 'Xbox generation' soldiers with tweaked games]]>http://www.engadget.com/2011/12/29/british-training-xbox-generation-soldiers-with-tweaked-games/http://www.engadget.com/2011/12/29/british-training-xbox-generation-soldiers-with-tweaked-games/http://www.engadget.com/2011/12/29/british-training-xbox-generation-soldiers-with-tweaked-games/#comments
Austerity means the military can't afford the big-budget training exercises to battle-harden new recruits, so it's relying more on computer simulations. Sadly, Virtual Battlespace 2 can't compete with the Hollywood-style excitement of Modern Warfare. That's why it's buying in game engines from the studios (VB2 was based on tech licensed from the makers of Operation Flashpoint) and cutting out the unrealistic physics -- such as rifle bullets flying three miles and vehicles that don't obey gravity. It's hoped the project will keep the attention of death-match hardened trainees and encourage them to play it in their own time: the team were told that two soldiers learned enough skills to stay alive during combat thanks to marathon sessions in the game. If you've just unwrapped an FPS for the holidays, you can now tell disapproving family members that it's educational.

British training 'Xbox generation' soldiers with tweaked games originally appeared on Engadget on Thu, 29 Dec 2011 14:51:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Combat SimulatorCombatSimulatorMinistry of DefenceMinistry of DefenseMinistryOfDefenceMinistryOfDefenseModern WarfareModernWarfareProject KITEProjectKiteSimulatorVB2Virtual Battlespace 2VirtualBattlespace2WarWarfareThu, 29 Dec 2011 14:51:00 EST<![CDATA[How The Gadget Show built its FPS simulator (video)]]>http://www.engadget.com/2011/10/24/how-the-gadget-show-built-its-fps-simulator-video/http://www.engadget.com/2011/10/24/how-the-gadget-show-built-its-fps-simulator-video/http://www.engadget.com/2011/10/24/how-the-gadget-show-built-its-fps-simulator-video/#comments
Remember The Gadget Show's FPS simulator that we showed you last week? Armed with naught but a pre-release level of Battlefield 3 and £500,000 ($650,000), it transformed a Birmingham studio into the sort of game room only multi-billionaires can dream of (as long as the dreams involved getting shot back, the sim comes packing paintball markers). The episode, which shows how this slice of gaming greatness came to be, has just finished airing here in the UK, where streaming and catch-up services aren't available to those outside the country. Fortunately for you lot, our friends at the show have uploaded the feature for you to watch in all its glory after the break.

Continue reading How The Gadget Show built its FPS simulator (video)

How The Gadget Show built its FPS simulator (video) originally appeared on Engadget on Mon, 24 Oct 2011 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Battlefield 3Battlefield3BF3Channel 5Channel5FPS SimFPS SimulatorFpsSimFpsSimulatorGame SimulatorgamesGameSimulatorgamingIgloo VisionIglooVisionJason BradburyJasonBradburyKinectKinect HackKinectHackMSE WeibullMseWeibullOmnidirectional TreadmillOmnidirectionalTreadmillPaintballPaintball MarkerPaintballMarkerSimSimsSimulatorSimulatorsSuzi PerrySuziPerryThe Gadget ShowTheGadgetShowvideoMon, 24 Oct 2011 16:00:00 EST<![CDATA[The Gadget Show builds an FPS simulator that shoots back (video)]]>http://www.engadget.com/2011/10/20/the-gadget-show-builds-an-fps-simulator-that-shoots-back-video/http://www.engadget.com/2011/10/20/the-gadget-show-builds-an-fps-simulator-that-shoots-back-video/http://www.engadget.com/2011/10/20/the-gadget-show-builds-an-fps-simulator-that-shoots-back-video/#comments
Racing simulators are ten a penny, but the closest an FPS player will get to an immersive experience is buying some branded peripherals. Armed with a pre-release level of Battlefield 3, The Gadget Show enlisted a team of design experts to transform a Birmingham studio into an FPS simulator costing £500,000 ($650,000). A four by nine meter video dome surrounds the player as they stand on an omni-directional treadmill that lets you walk wherever you want to go. Ten infra-red motion tracking cameras and a sensor on your gun enables the picture to follow where you point it and a Kinect hack controls your jumping and crouching. The fun doesn't stop there -- 12 paintball markers mean that every time you get shot in the game, you'll feel it. The show airs in the UK on October 24th at 8:00pm, Channel 5. We've got a behind the scenes gallery below (supplied by those lovely people from the show) as well as PR and a trailer after the break.

Gallery: The Gadget Show Battlefield 3 Simulator - Behind the Scenes Gallery

The Gadget Show Battlefield 3 Simulator - Behind the Scenes Gallery

Continue reading The Gadget Show builds an FPS simulator that shoots back (video)

Filed under: ,

The Gadget Show builds an FPS simulator that shoots back (video) originally appeared on Engadget on Thu, 20 Oct 2011 03:50:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Battlefield 3Battlefield3BF3Channel 5Channel5FPS SimFPS SimulatorFpsSimFpsSimulatorGame SimulatorGameSimulatorIgloo VisionIglooVisionJason BradburyJasonBradburyKinectKinect HackKinectHackMSE WeibullMseWeibullOmnidirectional TreadmillOmnidirectionalTreadmillPaintballPaintball MarkerPaintballMarkerSimSimsSimulatorSimulatorsSuzi PerrySuziPerryThe Gadget ShowTheGadgetShowvideoThu, 20 Oct 2011 03:50:00 EST<![CDATA[This concept wants you to smell it, smell it, Smellit]]>http://www.engadget.com/2011/10/09/this-concept-wants-you-to-smell-it-smell-it-smellit/http://www.engadget.com/2011/10/09/this-concept-wants-you-to-smell-it-smell-it-smellit/http://www.engadget.com/2011/10/09/this-concept-wants-you-to-smell-it-smell-it-smellit/#comments We admit it: this could just be another highfalutin gadget render that'll never breathe the polluted whiff of day. But it's a nice render, which demonstrates a concept called the Smellit: a miniature olfactory factory that's meant to connect to your PC and bring a "fourth dimension" to video and gaming. Its creator, Nuno Teixeira, even claims he's found a French company to build the device and show it off at the Lisbon Design Show next week. Now, the principle of a practically-sized scent generator has already been demonstrated by others, but we won't be convinced until we have to open a window.

This concept wants you to smell it, smell it, Smellit originally appeared on Engadget on Sun, 09 Oct 2011 04:02:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>4dconceptfourth dimensionFourthDimensionfragranceLisbon Design ShowLisbonDesignShownuno teixeiraNunoTeixeirarenderscentsimulatorsmellSmellitweirdwhiffZohanSun, 09 Oct 2011 04:02:00 EST<![CDATA['Mommy Tummy' simulator takes you from normal to pregnant in two minutes (video)]]>http://www.engadget.com/2011/09/22/mommy-tummy-simulator-takes-you-from-normal-to-pregnant-in-two/http://www.engadget.com/2011/09/22/mommy-tummy-simulator-takes-you-from-normal-to-pregnant-in-two/http://www.engadget.com/2011/09/22/mommy-tummy-simulator-takes-you-from-normal-to-pregnant-in-two/#comments
You can test drive a car before buying it, so why not take the same approach to pregnancy? Such is the idea, apparently, behind the "Mommy Tummy" -- a system that gives women (or men) a taste of what it would feel like to have a bun in the oven, even if they haven't received any lovin'. Developed by researchers at Japan's Kanagawa Institute of Technology, this simulator invites users to don a jacket replete with rubber balloons, vibrators, a water bag and other things you'd expect to find in Buffalo Bill's basement. Once strapped on, the jacket's midsection gradually expands as it swells with warm water funneled in from an adjacent tank, resulting in an immaculately conceived baby bump. A compressor, meanwhile, slowly augments the jacket's chest area, while a separate array of balloons rapidly inflate and deflate, thereby mimicking the kicking and side-to-side movements of a real-life fetus. KIRF mothers can monitor their KIRF baby's vital signs on a monitor, though they'll have to pay close attention. Unlike real pregnancies, the Mommy Tummy's gestation period lasts a merciful two minutes, giving your boyfriend just enough time to formulate a coherent response. Must-see video footage after the break.

Update: Turns out our bros at Joystiq got some hands-on time with this bundle of joy at TGS. Check it out.

[Image courtesy of Toutlecine.com]

Continue reading 'Mommy Tummy' simulator takes you from normal to pregnant in two minutes (video)

'Mommy Tummy' simulator takes you from normal to pregnant in two minutes (video) originally appeared on Engadget on Thu, 22 Sep 2011 09:12:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>abdomenbabybaby bumpBabyBumphealthjapanKanagawa Institute of TechnologyKanagawaInstituteOfTechnologymedicinemommommy tummyMommyTummymothermotherhoodparenthoodpregnancypregnancy simulatorPregnancySimulatorpregnantresearchsciencesimulatorvideovital signsVitalSignswomenThu, 22 Sep 2011 09:12:00 EST<![CDATA[Leaked BlackBerry Bold Touch simulation offers tire-kickers a bumpy joyride]]>http://www.engadget.com/2011/05/30/leaked-blackberry-bold-touch-simulation-offers-tire-kickers-a-bu/http://www.engadget.com/2011/05/30/leaked-blackberry-bold-touch-simulation-offers-tire-kickers-a-bu/http://www.engadget.com/2011/05/30/leaked-blackberry-bold-touch-simulation-offers-tire-kickers-a-bu/#comments If you ache to get your hands on the BlackBerry Bold Touch and lack any semblance of patience, RIM's recently leaked simulator offers an opportunity to vicariously manhandle its upcoming creation -- all from the comfort of your Windows computer. Although the software isn't without quirks (as evidenced above), the 177MB download includes system v6.1.0.55 -- more commonly known as BlackBerry 7 OS. The functionality is rather robust, and we happily took the web browser for a quick drive around the block. It provided a pleasant rendering of our sister-site Autoblog, but the simulator started sputtering once we approached our own domain. Perhaps you'll have better luck. So, if you're suitably equipped and a wee bit curious, you can start kicking these tires by following the source.

[Thanks, Zaoist]

Leaked BlackBerry Bold Touch simulation offers tire-kickers a bumpy joyride originally appeared on Engadget on Mon, 30 May 2011 20:16:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>99009930bb os 7bb6bb7BbOs7BlackBerryblackberry 6Blackberry 7BlackBerry Bold TouchBlackBerry OS 6.1blackberry os 7Blackberry6Blackberry7BlackberryBoldTouchBlackberryOs6.1BlackberryOs7Bold 9000bold 9930bold touchBold9000Bold9930BoldTouchemulatorleakleakedleaksmobileResearch In MotionResearchInMotionRIMsimulationsimulatorsmartphonesmartphonestouchMon, 30 May 2011 20:16:00 EST<![CDATA[Audio battlefield would prepare troops for combat or a typical Slayer concert]]>http://www.engadget.com/2011/05/09/audio-battlefield-would-prepare-troops-for-combat-or-a-typical-s/http://www.engadget.com/2011/05/09/audio-battlefield-would-prepare-troops-for-combat-or-a-typical-s/http://www.engadget.com/2011/05/09/audio-battlefield-would-prepare-troops-for-combat-or-a-typical-s/#comments
Ever wondered how well playing Call of Duty at maximum volume mimics a real combat experience? Researchers at the Missouri University of Science and Technology must have asked a similar question, because they've built a 64-speaker surround-sound audio battlefield designed to train new troops. The system reproduces screaming fighter jets, rumbling tanks, and persistent gunfire -- all the better to acclimate recruits to the overwhelming, disorienting cacophony of warfare. Veterans say even with the four large 20-hertz subwoofers, it's nowhere near the real thing: combat volume is 25 percent louder than the average rock concert, at levels that can cause permanent hearing loss. Still, the creators say every bit of training helps; having near-combat experience is certainly better than none at all. So tell that to your neighbors next time they bang on your wall.

[Image via The Associated Press]

Audio battlefield would prepare troops for combat or a typical Slayer concert originally appeared on Engadget on Mon, 09 May 2011 08:53:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>audioaudio battlefieldAudioBattlefieldbattlefieldcombatMissouri University of Science and TechnologyMissouriUniversityOfScienceAndTechnologyMUSTsimssimulationsimulatorsoundsoundsSteven GrantStevenGrantsurround-soundtroopsVeteranswarwarfarewargadgetMon, 09 May 2011 08:53:00 EST<![CDATA[Download DARPA's sub-hunting sim, help train its ACTUV automaton]]>http://www.engadget.com/2011/04/08/download-darpas-sub-hunting-sim-help-train-its-actuv-automaton/http://www.engadget.com/2011/04/08/download-darpas-sub-hunting-sim-help-train-its-actuv-automaton/http://www.engadget.com/2011/04/08/download-darpas-sub-hunting-sim-help-train-its-actuv-automaton/#comments DARPA dabbles in all matter of defense drones, and it's no stranger to leveraging the wisdom of the masses to help develop tomorrow's military machinery. The agency's latest program to go the crowdsourcing route is its Anti-submarine Warfare Continuous Trail Unmanned Vessel (ACTUV), and it wants you to help develop the software that'll control the thing. DARPA's borrowed a bit of the Sonalysts Combat Simulations Dangerous Waters game to create the ACTUV Tactics Simulator, where players complete missions tracking a target sub while navigating through and around commercial ocean traffic. Would-be captains can then choose to submit their strategies and game data to DARPA for use in shoring up the autonomous seabot's strategic submarine pursuit software. Hit the source link for a free download and dive into the sub-hunting action.

Download DARPA's sub-hunting sim, help train its ACTUV automaton originally appeared on Engadget on Fri, 08 Apr 2011 23:47:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ACTUVACTUV tactics simulatorActuvTacticsSimulatorACUTUV x shipacutuv x-shipAcutuvX-shipAcutuvXShipautonomousboatcrowdsourcecrowdsourcingDARPAmilitarynavyrobotshipsimsimulationsimulatorsoftwaresubmarinetrackingwargadgetFri, 08 Apr 2011 23:47:00 EST<![CDATA[ZMP's City Simulator Experiment takes the driver out of the car, keeps the helmet just in case (video)]]>http://www.engadget.com/2011/01/31/zmps-city-simulator-experiment-takes-the-driver-out-of-the-car/http://www.engadget.com/2011/01/31/zmps-city-simulator-experiment-takes-the-driver-out-of-the-car/http://www.engadget.com/2011/01/31/zmps-city-simulator-experiment-takes-the-driver-out-of-the-car/#commentsZMP's City Simulator Experiment takes the driver out of the car, keeps the helmet just in case (video) ZMP has done some great things in the past -- well, except maybe Miuro, the roving iPod dock that ensured your PMP would always be just out of reach. Lately the company has been focusing on self-driving cars like the RoboCar MEV, and while this little one most certainly does have a driver, that driver is not actually in the car. It's a potential roadway revolution. Just imagine being able to partake in your morning commute from the safety of your own home! Right now it's just a little RC car (not unlike Malte Jehmlich's telepresence Wipeout from last year) being steered by what looks like a Logitech Driving Force GT, making us hope that the next Gran Turismo offers a mode just like this -- minus the headgear.

Continue reading ZMP's City Simulator Experiment takes the driver out of the car, keeps the helmet just in case (video)

ZMP's City Simulator Experiment takes the driver out of the car, keeps the helmet just in case (video) originally appeared on Engadget on Mon, 31 Jan 2011 15:29:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>city simulator experimentCitySimulatorExperimentdriving force gtdriving simulatorDrivingForceGtDrivingSimulatorlogitechrc carRcCarsimulatortelepresencevideozero motion pointZeroMotionPointzmpMon, 31 Jan 2011 15:29:00 EST<![CDATA[BlackBerry PlayBook Simulator Beta hands-on]]>http://www.engadget.com/2010/10/25/blackberry-playbook-simulator-beta-hands-on/http://www.engadget.com/2010/10/25/blackberry-playbook-simulator-beta-hands-on/http://www.engadget.com/2010/10/25/blackberry-playbook-simulator-beta-hands-on/#comments Sure, you might have to be at Adobe's MAX conference to actually hold a PlayBook in your hand... but RIM's offering us all the next best thing by turning a beta version of its PlayBook simulator loose on devs way, way in advance of the tablet's release -- ostensibly in the hopes of drumming up a beefy third-party app catalog in time for retail. On that note, we've spent a few minutes playing with the simulator today, which is delivered in the form of an ISO that can be loaded as an operating system installer for a VMWare virtual machine on either Windows or Mac. There's seriously very little to see here so far, but you can play with the on-screen landscape keyboard, confirm the presence of inertial scrolling in text areas, and get a quick look at how the status and app bars work. Speaking of apps, there aren't any -- not a single one -- but it's way early, and that's obviously where RIM hopes you come into play with that million-dollar software idea of yours. Follow the break for a video walkthrough!

Gallery: BlackBerry PlayBook Simulator Beta hands-on

Continue reading BlackBerry PlayBook Simulator Beta hands-on

BlackBerry PlayBook Simulator Beta hands-on originally appeared on Engadget on Mon, 25 Oct 2010 18:51:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adobebetablackberryhands-onmixplaybookqnxrimsimulatorvideoMon, 25 Oct 2010 18:51:00 EST<![CDATA[RIM announces PlayBook simulator and SDK for BlackBerry Tablet OS]]>http://www.engadget.com/2010/10/25/rim-announces-playbook-simulator-and-sdk-for-blackberry-tablet-o/http://www.engadget.com/2010/10/25/rim-announces-playbook-simulator-and-sdk-for-blackberry-tablet-o/http://www.engadget.com/2010/10/25/rim-announces-playbook-simulator-and-sdk-for-blackberry-tablet-o/#comments
We know you're all partyin' up a storm at the Adobe MAX conference, but just in case one of you missed it, RIM's announced the availability of the Adobe AIR SDK for BlackBerry Tablet OS -- not to mention a little something called the BlackBerry PlayBook Simulator. Needless to say (but we'll say it anyways), we're more than anxious to get our hands on the latter. Unfortunately, it requires Adobe AIR 2.5 to run, while the latest release RIM's site is offering is 2.0.2. Buzzkill, right? That said, we suggest you keep an eye on the source link if you're looking to get in on the action yourself. Otherwise, if you're not willing to go all the way, we have some fine PR explaining matters after the break.

Update: The source link has an active AIR 2.5 toolkit link. Huzzah!

Continue reading RIM announces PlayBook simulator and SDK for BlackBerry Tablet OS

RIM announces PlayBook simulator and SDK for BlackBerry Tablet OS originally appeared on Engadget on Mon, 25 Oct 2010 09:59:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>adobeadobe airadobe maxAdobeAirAdobeMaxairblackberryblackberry playbookblackberry playbook simulatorblackberry tablet osBlackberryPlaybookBlackberryPlaybookSimulatorBlackberryTabletOscanadadeveloperdevelopmentmotionresearch in motionResearchInMotionrimsdksimulatortablettablet osTabletOsMon, 25 Oct 2010 09:59:00 EST<![CDATA[Robot arm takes engineers for a virtual reality Formula 1 ride (video)]]>http://www.engadget.com/2010/08/07/robot-arm-takes-engineers-for-a-virtual-reality-formula-1-ride/http://www.engadget.com/2010/08/07/robot-arm-takes-engineers-for-a-virtual-reality-formula-1-ride/http://www.engadget.com/2010/08/07/robot-arm-takes-engineers-for-a-virtual-reality-formula-1-ride/#comments As it turns out, industrial-strength robot arms are good for more than amusing hijinks and the occasional assembly line -- a team of researchers at Germany's Max Planck Institute for Biological Cybernetics have turned a KUKA KR 500 into the ultimate Formula 1 simulator ride. Outfitting the six-axis, half-ton lifter with a force-feedback steering wheel, pedals, video projector and curved screen, the newly-christened CyberMotion Simulator lets scientists throw a virtual Ferrari F2007 race car into the turns, while the cockpit whips around with up to 2 Gs of equal-and-opposite Newtonian force. There's actually no loftier goal for this particular science project, as the entire point was to create a racing video game that feels just like the real thing -- though to be fair, a second paper tested to see whether projectors or head-mounted displays made for better drivers. (Projectors won.) See how close they came to reality in a video after the break, while we go perform a little experiment of our own.

[Thanks, Eric]

Continue reading Robot arm takes engineers for a virtual reality Formula 1 ride (video)

Robot arm takes engineers for a virtual reality Formula 1 ride (video) originally appeared on Engadget on Sat, 07 Aug 2010 18:04:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>6DOFCyberMotionDrivingdriving simulatordriving simulatorsDrivingSimulatorDrivingSimulatorsF1FerrariFormula 1Formula1kukakuka 500kuka roboticsKuka500KukaRoboticsmax planck instituteMax Planck Institute for Biological CyberneticsMaxPlanckInstituteMaxPlanckInstituteForBiologicalCyberneticsRobocoasterrobotrobot armrobot armsRobotArmRobotArmsRobotssimulationsimulationssimulatorSimulatorssix-axisvideovirtual realityVirtualRealitySat, 07 Aug 2010 18:04:00 EST<![CDATA[Engadget test-drives Festo AirMotion Ride, humiliates self (video)]]>http://www.engadget.com/2010/04/09/engadget-test-drives-festo-airmotion-ride-humiliates-self-vide/http://www.engadget.com/2010/04/09/engadget-test-drives-festo-airmotion-ride-humiliates-self-vide/http://www.engadget.com/2010/04/09/engadget-test-drives-festo-airmotion-ride-humiliates-self-vide/#comments Festo may've already stirred up plenty of attention with its mesmerizing AirPenguin blimp, but let's not forget its other weapon -- fluidic muscles (elastomer tubes that contract when filled with fluid). At The Gadget Show Live in the UK, this German company was also showing off its AirMotion Ride car-racing simulator -- essentially a driver's seat suspended from just six fluidic muscles for the six degrees of freedom, while sound and vision are handled by its 5.1 surround sound speakers and a projector. The company claims that each of these lightweight muscles can generate forces of up to 1,600N, and since there are no mechanical parts inside, they make an ideal replacement for conventional hydraulic plungers as used on Force Dynamics' and Motion-Sim's simulators. You can see Festo's machine in action after the break, but promise us that you won't judge our driving ability.

Gallery: Festo AirMotion Ride hands-on

Continue reading Engadget test-drives Festo AirMotion Ride, humiliates self (video)

Engadget test-drives Festo AirMotion Ride, humiliates self (video) originally appeared on Engadget on Fri, 09 Apr 2010 13:37:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>airmotionairmotion rideAirmotionRideawesomebionicdriving simulatorDrivingSimulatorfeaturedfeaturesfestofesto airmotionfesto airmotion rideFestoAirmotionFestoAirmotionRidefluidic muscleFluidicMusclehands-onpneumatic musclePneumaticMuscleracing gameracing simulatorRacingGameRacingSimulatorsimulatorthe gadget show livethe gadget show live 2010TheGadgetShowLiveTheGadgetShowLive2010videoFri, 09 Apr 2010 13:37:00 EST<![CDATA[iPhone OS 4 hands-on (updated with video!)]]>http://www.engadget.com/2010/04/08/iphone-os-4-hands-on/http://www.engadget.com/2010/04/08/iphone-os-4-hands-on/http://www.engadget.com/2010/04/08/iphone-os-4-hands-on/#comments Okay, so we're currently holding our breath while the developer preview of iPhone OS 4 installs on our 3GS -- a process that seems to be, uh, not going so well, but we wanted to share these quick shots we took from the simulator in the meantime. The dock is now 3D, like the one in Snow Leopard and on the iPad, multitasking works just like you'd expect -- you can swipe left and right to see more open apps -- and the Game Center app is present, although not functional. There's also Events and Faces in the Photos app, which you'd expect after the iPad version got them. We've got our fingers crossed that our latest restore attempt is going to work, so check back in a few for a video walkthrough, but hit the gallery below in the meantime!

Update: Wonder of wonders, we actually got the bugger working! We're doing video right now, let us know what you want to see -- and check out some on-device shots below.

Update 2: Video time! We also added some impressions, it's all after the break.

Gallery: iPhone OS 4 simulator screenshots


Gallery: iPhone OS 4.0 device screenshots

Continue reading iPhone OS 4 hands-on (updated with video!)

iPhone OS 4 hands-on (updated with video!) originally appeared on Engadget on Thu, 08 Apr 2010 18:02:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>appleemulatorhands-oniphoneiphone osiphone os 4iphone os 4.0IphoneOsIphoneOs4IphoneOs4.0simulatorvideoThu, 08 Apr 2010 18:02:00 EST<![CDATA[CBS testing HTML5 iPad video out in the open, sorry Flash]]>http://www.engadget.com/2010/03/25/cbs-testing-html5-ipad-video-out-in-the-open/http://www.engadget.com/2010/03/25/cbs-testing-html5-ipad-video-out-in-the-open/http://www.engadget.com/2010/03/25/cbs-testing-html5-ipad-video-out-in-the-open/#comments Hey Dan, ever heard of a staging area to do your testing? Apparently not judging by the screenshot above. MacRumors took that "iPad - test - dan config - 3" content from the CBS.com homepage for a spin and discovered what appears to be HTML5 (not Flash) video. A bit more sleuthing reveals several "webkit" (the foundation of the iPad's and iPhone's mobile Safari browser) calls after peeling open the CSS. This suggests that CBS is preparing to serve up parallel HTML5 content with the launch of the notoriously Flash-less iPad -- take that Hulu -- becoming yet another high-profile company swayed into providing video and other content in an Apple friendly format. Then again, maybe CBS is just testing a "what if" scenario with no intention of moving this into production any time soon. US netizens can try it themselves by setting your browser to spoof the iPad's user agent and hitting the source below (for as long as it lasts) but you'll need the iPad SDK Simulator to view the actual HTML5 videos.

CBS testing HTML5 iPad video out in the open, sorry Flash originally appeared on Engadget on Thu, 25 Mar 2010 05:09:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>applecbsflashhtml5huluipadiphonemacrumorssimulatorThu, 25 Mar 2010 05:09:00 EST<![CDATA[Robotic Surgical Simulator lets doctors sharpen their skills by operating on polygons]]>http://www.engadget.com/2010/02/26/robotic-surgical-simulator-lets-doctors-sharpen-their-skills-by/http://www.engadget.com/2010/02/26/robotic-surgical-simulator-lets-doctors-sharpen-their-skills-by/http://www.engadget.com/2010/02/26/robotic-surgical-simulator-lets-doctors-sharpen-their-skills-by/#commentsRobotic Surgical Simulator lets doctors sharpen their skills by operating on polygons These days you wouldn't jump behind the controls of a real plane without logging a few hours on the simulator, and so we're glad to hear that doctors no longer have to grab the controls of a da Vinci surgical robot without performing some virtual surgeries first. The Center for Robotic Surgery at Roswell Park Cancer Institute and the University of Buffalo School of Engineering have collaborated to create RoSS, the Robotic Surgical Simulator. Unlike our Ross, who works odd hours and covers fuel cell unveils with innate skill, this RoSS allows doctors to slice and dice virtual patients without worrying about any messy cleanups -- or messy lawsuits. We're guessing it'll be awhile before consumer versions hit the market, but just in case we've gone ahead and put our pre-orders in for the prostate expansion to Microsoft Cutting Sim 2014[TM].

Robotic Surgical Simulator lets doctors sharpen their skills by operating on polygons originally appeared on Engadget on Fri, 26 Feb 2010 09:43:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>buffalocenter for robotic surgerycenter for robotic surgery at roswell park cancer instituteCenterForRoboticSurgeryCenterForRoboticSurgeryAtRoswellParkCancerInstituteda vincida vinci surgery robotDaVinciDaVinciSurgeryRobotrobotic surgery simulatorRoboticSurgerySimulatorrossroswell park cancer instituteRoswellParkCancerInstitutesimsimulatorsurgeryuniversity of buffalouniversity of buffalo school of engineeringUniversityOfBuffaloUniversityOfBuffaloSchoolOfEngineeringFri, 26 Feb 2010 09:43:00 EST<![CDATA[Baby simulator surfaces in Japan, Devo wants its mascot back (video)]]>http://www.engadget.com/2009/12/18/baby-simulator-surfaces-in-japan-devo-wants-its-mascot-back-vi/http://www.engadget.com/2009/12/18/baby-simulator-surfaces-in-japan-devo-wants-its-mascot-back-vi/http://www.engadget.com/2009/12/18/baby-simulator-surfaces-in-japan-devo-wants-its-mascot-back-vi/#comments
When we first saw Yotaro baby simulator we thought: "we've seen this ugly robot before." And no, weren't thinking about Keiko, the robot patient currently seeing action in teaching hospitals in Japan. It just so happens that robot in question has more than a passing resemblance to Booji Boy, a character beloved to Devo fans world-wide. The robot, developed at the University of Tsukuba, is designed to teach people about childcare and parenting by portraying various facial expressions, movements, and physiological traits associated with babies, relying on a Rube Goldberg-esque array of water tanks, projectors, sensors, and sophisticated emotion control software to respond to your actions appropriately. If you think it looks strange above, wait until you see it in action! Check it out after the break.

Continue reading Baby simulator surfaces in Japan, Devo wants its mascot back (video)

Baby simulator surfaces in Japan, Devo wants its mascot back (video) originally appeared on Engadget on Fri, 18 Dec 2009 19:31:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>babybaby simulatorBabySimulatorjapansimulatorUniversity of TsukubaUniversityOfTsukubayotaroFri, 18 Dec 2009 19:31:00 EST<![CDATA[RIM posts new BlackBerry widget APIs, dev kit]]>http://www.engadget.com/2009/10/09/rim-posts-new-blackberry-widget-apis-dev-kit/http://www.engadget.com/2009/10/09/rim-posts-new-blackberry-widget-apis-dev-kit/http://www.engadget.com/2009/10/09/rim-posts-new-blackberry-widget-apis-dev-kit/#comments
We know you love widgets, so feast your eyes on this: RIM has just announced a software development kit for creating web-based widgets on the BlackBerry platform. With new APIs that allow access to a everything from email and calendar applications to the GPS, media player, files and documents stored on the smartphone, the handset's push technology and more, hot-to-trot software developers such as yourself can build all kinds of crazy apps for OS 5. What are you waiting for? Hit the read link for everything you need -- including the Smartphone Simulator and BlackBerry Widget SDK beta. And be sure you drop us a line after creating some award-winning apps. PR after the break.

[Via PhoneArena]

Continue reading RIM posts new BlackBerry widget APIs, dev kit

Filed under: , ,

RIM posts new BlackBerry widget APIs, dev kit originally appeared on Engadget on Fri, 09 Oct 2009 13:26:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>blackberryblackberry osblackberryoscellphonesdev kitDevKitemulatormobileresearch in motionresearchinmotionrimsdksimulatorWidgetsFri, 09 Oct 2009 13:26:00 EST<![CDATA[RIM posts new BlackBerry widget APIs, dev kit]]>http://www.engadget.com/2009/10/09/rim-posts-new-blackberry-widget-apis-dev-kit/http://www.engadget.com/2009/10/09/rim-posts-new-blackberry-widget-apis-dev-kit/http://www.engadget.com/2009/10/09/rim-posts-new-blackberry-widget-apis-dev-kit/#comments
We know you love widgets, so feast your eyes on this: RIM has just announced a software development kit for creating web-based widgets on the BlackBerry platform. With new APIs that allow access to a everything from email and calendar applications to the GPS, media player, files and documents stored on the smartphone, the handset's push technology and more, hot-to-trot software developers such as yourself can build all kinds of crazy apps for OS 5. What are you waiting for? Hit the read link for everything you need -- including the Smartphone Simulator and BlackBerry Widget SDK beta. And be sure you drop us a line after creating some award-winning apps. PR after the break.

[Via PhoneArena]

Continue reading RIM posts new BlackBerry widget APIs, dev kit

Filed under:

RIM posts new BlackBerry widget APIs, dev kit originally appeared on Engadget on Fri, 09 Oct 2009 13:26:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>blackberrycellphonesdev kitDevKitemulatorrimsdksimulatorWidgetsFri, 09 Oct 2009 13:26:00 EST<![CDATA[SimMan 3G patient simulator will undoubtedly creep you out]]>http://www.engadget.com/2009/04/03/simman-3g-patient-simulator-will-undoubtedly-creep-you-out/http://www.engadget.com/2009/04/03/simman-3g-patient-simulator-will-undoubtedly-creep-you-out/http://www.engadget.com/2009/04/03/simman-3g-patient-simulator-will-undoubtedly-creep-you-out/#comments
Look, we want the next generation of robot doctors to be as competent as possible; after all, it's them that'll likely be taking care of us when our fingers lock up and our cranium-housed SSDs finally fail. That said, we can't help but be freaked completely out by Laerdal's latest and greatest patient simulator, the SimMan 3G. This almost-human can be programmed with various practice scenarios for to-be doctors to hone their skills on, and as any sophisticated mannequin should, this one is also wireless, self-contained and able to withstand four hours of surgery before conking out. We have no clue how many thousands this thing will set HOSA clubs around the nation back, but anything that bleeds, winks, and secretes shouldn't be something you "buy," anyway.

Filed under:

SimMan 3G patient simulator will undoubtedly creep you out originally appeared on Engadget on Fri, 03 Apr 2009 06:01:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>healthLaerdalmedicalmedicinepatient simulatorPatientSimulatorsimmansimman 3gSimman3gsimulationsimulatorFri, 03 Apr 2009 06:01:00 EST<![CDATA[Australian continues to hone $300,000 flight simulator]]>http://www.engadget.com/2009/03/13/australian-continues-to-hone-300-000-flight-simulator/http://www.engadget.com/2009/03/13/australian-continues-to-hone-300-000-flight-simulator/http://www.engadget.com/2009/03/13/australian-continues-to-hone-300-000-flight-simulator/#comments
Ha, and you thought your HotSeat Chassis was the next best thing to paying way too much to carry an appropriate amount of luggage on your next jaunt to paradise. Australia's own Matthew Sheil has been tinkering on his own personal flight simulator for over a decade now, but the latest iteration is just too good to ignore. Aside from setting a Guinness world record for his efforts, the man has poured over $300,000 into recreating the flying experience of a 747-400, which is dirt cheap compared to the $60 million that professional simulators generally run. Sheil flies virtually with legions of other enthusiasts around the world, and each year he hosts 15 folks as they rotate on an around-the-world flight that Qantas sponsors and where donation money is funneled to the Royal Flying Doctor Service. Hit up the read link to get a real gist of what this thing is capable of, and feel free to go in with stupid high expectations.

Filed under: ,

Australian continues to hone $300,000 flight simulator originally appeared on Engadget on Fri, 13 Mar 2009 09:57:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>airplaneaustraliaaustralianflightflight simulatorFlightSimulatorplanesimulationsimulatorFri, 13 Mar 2009 09:57:00 EST<![CDATA[SKIGYM simulator lets you break a hip from the comfort of your living room]]>http://www.engadget.com/2009/01/02/skigym-simulator-lets-you-break-a-hip-from-the-comfort-of-your-l/http://www.engadget.com/2009/01/02/skigym-simulator-lets-you-break-a-hip-from-the-comfort-of-your-l/http://www.engadget.com/2009/01/02/skigym-simulator-lets-you-break-a-hip-from-the-comfort-of-your-l/#comments
The Wii Balance Board may be all well and good if you want to play things safe, but those looking to up the danger level a tad will no doubt want to give this new SKIGYM simulator some serious consideration, with it promising to improve your skiing ability and give you a workout in the process. Apparently, you can either hook the fully-motorized device up to your PC and play the included Alpine Ski Racing game, or simply use it on its own as a piece of exercise equipment -- we're guessing it's also only a matter of time before someone uses it to control a robot. Not surprisingly, this piece of living room clutter will also put quite a dent in the old bank account, with it running €1,649, or roughly $2,300.

[Via Random Good Stuff]

Filed under: ,

SKIGYM simulator lets you break a hip from the comfort of your living room originally appeared on Engadget on Fri, 02 Jan 2009 22:41:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>simulatorski home simulatorski simulatorSkiHomeSimulatorSkiSimulatorFri, 02 Jan 2009 22:41:00 EST<![CDATA[RIM posts BlackBerry Storm emulator, dev tools]]>http://www.engadget.com/2008/10/08/rim-posts-blackberry-storm-emulator-dev-tools/http://www.engadget.com/2008/10/08/rim-posts-blackberry-storm-emulator-dev-tools/http://www.engadget.com/2008/10/08/rim-posts-blackberry-storm-emulator-dev-tools/#comments
It's just in beta at this point, but devs and techies far and wide are now invited to take a stab at coding up some magic for RIM's new touch-based user interface elements, orientation control, accelerometers, and virtual keyboards that are getting proudly shown off for the first time in the Storm. There's stuff in here for regular folk without a single programming bone in their bodies, too -- namely, a full-fledged emulator that appears to have all the features and functionality you'd expect the real thing to have. It's a gas to play with -- even more fun than that semi-functional G1 demo T-Mobile has up and running -- and it's a good way to test-drive the goods without laying out the cash first. Not to say you could even if you wanted to, since the phone's not dropping for another month at a yet-to-be-determined sticker price.

[Via Phone Scoop]

Update: Be sure to select Simulators v4.7.0 to get the goods -- otherwise you're going to go through some ridiculously long download, only to discover that there's no Storm to be found. Wouldn't that just suck?

Filed under: ,

RIM posts BlackBerry Storm emulator, dev tools originally appeared on Engadget on Wed, 08 Oct 2008 14:56:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>9530blackberryemulatorrimsdksimulatorstormWed, 08 Oct 2008 14:56:00 EST<![CDATA[RIM posts BlackBerry Storm emulator, dev tools]]>http://www.engadget.com/2008/10/08/rim-posts-blackberry-storm-emulator-dev-tools/http://www.engadget.com/2008/10/08/rim-posts-blackberry-storm-emulator-dev-tools/http://www.engadget.com/2008/10/08/rim-posts-blackberry-storm-emulator-dev-tools/#comments
It's just in beta at this point, but devs and techies far and wide are now invited to take a stab at coding up some magic for RIM's new touch-based user interface elements, orientation control, accelerometers, and virtual keyboards that are getting proudly shown off for the first time in the Storm. There's stuff in here for regular folk without a single programming bone in their bodies, too -- namely, a full-fledged emulator that appears to have all the features and functionality you'd expect the real thing to have. It's a gas to play with -- even more fun than that semi-functional G1 demo T-Mobile has up and running -- and it's a good way to test-drive the goods without laying out the cash first. Not to say you could even if you wanted to, since the phone's not dropping for another month at a yet-to-be-determined sticker price.

[Via Phone Scoop]

Update: Be sure to select Simulators v4.7.0 to get the goods -- otherwise you're going to go through some ridiculously long download, only to discover that there's no Storm to be found. Wouldn't that just suck?

Filed under: ,

RIM posts BlackBerry Storm emulator, dev tools originally appeared on Engadget on Wed, 08 Oct 2008 14:56:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>9530blackberryemulatormobileresearch in motionresearchinmotionrimsdksimulatorstormWed, 08 Oct 2008 14:56:00 EST<![CDATA[ST-2 shooting simulator keeps your aim sharp]]>http://www.engadget.com/2008/07/08/st-2-shooting-simulator-keeps-your-aim-sharp/http://www.engadget.com/2008/07/08/st-2-shooting-simulator-keeps-your-aim-sharp/http://www.engadget.com/2008/07/08/st-2-shooting-simulator-keeps-your-aim-sharp/#comments
And you thought using the HIPerSpace wall for GTA IV was overkill. Marksman Training Systems' ST-2 shooting simulator is touted as the "first simulator for shotgun and rifle shooting designed specifically for demanding users such as shooting instructors," and considering that the Russian and Slovakian national clay shooting teams have practiced on this very system in preparation for the Beijing Olympics, we'll be seeing just how effective it is here soon. Furthermore, this system allows hunters / huntresses to use their preferred weapon (via an attachable sensor) rather than some proprietary pistol, and the advanced diagnostics screen ensures that you know exactly why you missed that digital fowl. Looks like you'll have to inquire directly about pricing, but seriously, you don't want this taking the place of your home cinema... or do you?

[Via CrunchGear]

Filed under:

ST-2 shooting simulator keeps your aim sharp originally appeared on Engadget on Tue, 08 Jul 2008 09:22:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>huntingMarksman Training SystemsMarksmanTrainingSystemsshootingShooting Simulator ST-2ShootingSimulatorSt-2simulationsimulatorST-2Tue, 08 Jul 2008 09:22:00 EST<![CDATA[E Ball's inflatable golf simulator saves you greens fees]]>http://www.engadget.com/2008/05/29/e-balls-inflatable-golf-simulator-saves-you-greens-fees/http://www.engadget.com/2008/05/29/e-balls-inflatable-golf-simulator-saves-you-greens-fees/http://www.engadget.com/2008/05/29/e-balls-inflatable-golf-simulator-saves-you-greens-fees/#comments
Never mind paying absurd quantities of cash to have some swing analyzer tell you how you'll never be like Tiger -- just pick yourself up one of these concoctions. E Ball's inflatable golf simulator not only consumes your entire backyard, it takes you back to those glory days of frolicking at the fair with your BFF, and it even allows you to practice your game in less-than-flawless weather. The device enables amateurs to work on their driving and putting, all without having to fetch balls afterwards or deal with the embarrassment of completely hacking it up in front of your more seasoned pals. It looks as if you'll have to ring up E Ball in order to get pricing details, but we don't envision this one coming in cheap.

[Via OhGizmo]

Filed under:

E Ball's inflatable golf simulator saves you greens fees originally appeared on Engadget on Thu, 29 May 2008 07:28:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>eballgamegolfGolf SimulatorGolfSimulatorinflatableSimulatorsportstoyThu, 29 May 2008 07:28:00 EST<![CDATA[Medic Vision intros haptic Mediseus Surgical Drilling Simulator]]>http://www.engadget.com/2008/05/15/medic-vision-intros-haptic-mediseus-surgical-drilling-simulator/http://www.engadget.com/2008/05/15/medic-vision-intros-haptic-mediseus-surgical-drilling-simulator/http://www.engadget.com/2008/05/15/medic-vision-intros-haptic-mediseus-surgical-drilling-simulator/#comments
We can't say we've ever felt the need to experience an accurate sensation of drilling through bone, but if you've always wondered what that was like (or, you know, are actually training to become a surgeon), you may want to take Medic Visions new Mediseus Surgical Drilling Simulator for a spin, which makes use of SensAble's PHANTOM haptic device for that added sense of realism. That'll apparently not only give you force feedback that's able to "distinguish between the feeling of different parts of the temporal bone drilling procedure," but some audio cues as well to round out the entire quease-inducing process. The system also comes equipped with a telelearning system that'll let a surgeon in one location show a trainee in another how it's done but, unfortunately, it doesn't appear to include an updated version of Operation to help residents put in those downtimes.

[Via Medgadget]

Filed under:

Medic Vision intros haptic Mediseus Surgical Drilling Simulator originally appeared on Engadget on Thu, 15 May 2008 15:01:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>force feedbackForceFeedbackhapticmedic visionMedicVisionmediseussensablesimulatorThu, 15 May 2008 15:01:00 EST<![CDATA[DARPA aims to create virtual environment for cyberwar simulations]]>http://www.engadget.com/2008/05/09/darpa-aims-to-create-virtual-environment-for-cyberwar-simulation/http://www.engadget.com/2008/05/09/darpa-aims-to-create-virtual-environment-for-cyberwar-simulation/http://www.engadget.com/2008/05/09/darpa-aims-to-create-virtual-environment-for-cyberwar-simulation/#comments Considering that mechanical beings will be fighting our real wars here in just a few years, it's no shock to see more focus placed on the areas where actual humans will still be the ones waging. DARPA is looking to create what it calls a National Cyber Range, which would essentially act as a training ground for cyber warriors. The setup would enable defense gurus to simulate battle against attacks our on nation's most highly prized data, and of course, give victors over virtual phishing scams immense bragging rights. Come to think of it, Estonia could have totally benefited from something like this last year.

[Via Information Week, image courtesy of Sandia]

Filed under:

DARPA aims to create virtual environment for cyberwar simulations originally appeared on Engadget on Fri, 09 May 2008 17:43:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>cyber threatCyberThreatcyberwardarpadefensehackerhackersmilitarynational cyber rangeNationalCyberRangesecuritysimulationsimulatorFri, 09 May 2008 17:43:00 EST<![CDATA[Force Dynamics 301 driving simulator takes on Super Mario Kart]]>http://www.engadget.com/2008/04/28/force-dynamics-301-driving-simulator-takes-on-super-mario-kart/http://www.engadget.com/2008/04/28/force-dynamics-301-driving-simulator-takes-on-super-mario-kart/http://www.engadget.com/2008/04/28/force-dynamics-301-driving-simulator-takes-on-super-mario-kart/#comments
While most of the cool kids are off whizzing around courses in Mario Kart Wii, the gurus at Force Dynamics are reminiscing about the one that started it all. Apparently the firm has tweaked its 301 motion platform to actually control the kart in the SNES hit, and the rider's chair even leaps up along with Mario, Peach or any other jumping character you choose. Sure, it's missing those absolutely brain-melting Wii graphics (but not by much, if you catch our drift), but we'd probably take a ride in this over an hour with the Wii Wheel any day. Check out the full video waiting after the break.

Continue reading Force Dynamics 301 driving simulator takes on Super Mario Kart

Filed under:

Force Dynamics 301 driving simulator takes on Super Mario Kart originally appeared on Engadget on Mon, 28 Apr 2008 16:15:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>arcadedrivingForce DynamicsForceDynamicsmario kartMarioKartsimulatorsnessuper mario kartsuper nintendoSuperMarioKartSuperNintendovideoMon, 28 Apr 2008 16:15:00 EST<![CDATA[Fruit fly flight simulator could smarten up robots]]>http://www.engadget.com/2008/04/26/fruit-fly-flight-simulator-could-smarten-up-robots/http://www.engadget.com/2008/04/26/fruit-fly-flight-simulator-could-smarten-up-robots/http://www.engadget.com/2008/04/26/fruit-fly-flight-simulator-could-smarten-up-robots/#commentsWondering just how we mere mortals were going to even give a robot enough smarts to completely overtake our societies? Oddly enough, some of that artificial brain power could come from studying the way fruit flies, um, fly. A completely bizarre flight simulator at Caltech actually plays "scenes" that flys react to, and considering that the fly is constantly held, researchers can closely examine how the insect attempts to navigate away from lines, blobs and all manners of incoming obstacles. Those working with the installation suggest that these studies could one day help autonomous robots function better, potentially taking some of the load off of our human workforce. We know, you've got three bold letters and a question mark running through your noggin right now -- just hit the read link to see what it's all about.

[Thanks, Dave]

Filed under:

Fruit fly flight simulator could smarten up robots originally appeared on Engadget on Sat, 26 Apr 2008 10:42:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>aiartificial intelligenceArtificialIntelligenceautonomousbraincaltechflightflight simulatorFlightSimulatorfruit flyFruitFlyresearchsimulatorvideoSat, 26 Apr 2008 10:42:00 EST<![CDATA[Toyota demos massive driving simulator, aims to nix traffic deaths]]>http://www.engadget.com/2007/11/26/toyota-demos-massive-driving-simulator-aims-to-nix-traffic-deat/http://www.engadget.com/2007/11/26/toyota-demos-massive-driving-simulator-aims-to-nix-traffic-deat/http://www.engadget.com/2007/11/26/toyota-demos-massive-driving-simulator-aims-to-nix-traffic-deat/#comments
Simulators similar to the one recently unveiled to the world by Toyota aren't all that uncommon, but this 4.5-meter high pod is "the first to move laterally and has the longest range of 35-meters front to back and 20-meters from right to left." Reportedly, the automaker plans to use its newest toy to "analyze driving characteristics under various conditions such as drunkenness and drowsiness" and subsequently decide what new safety features should be added to its fleet of motorcars. More specifically, the device enables researchers to "conduct driving tests that would be too dangerous to perform in the real world or that require specific driving conditions," and we're pretty sure the 360-degree concave video screen is quite the draw, too. Unfortunately, we have little faith that you'll ever see a tamed version of this here simulator at your local arcade, but one can hope, we suppose.

[Via Yahoo / Reuters, image courtesy of Tech.co.uk]

Filed under:

Toyota demos massive driving simulator, aims to nix traffic deaths originally appeared on Engadget on Mon, 26 Nov 2007 09:03:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>drivingdriving simulatorDrivingSimulatorsafetysimulatortoyotavehicleMon, 26 Nov 2007 09:03:00 EST